BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120613.seq (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 27 0.56 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 27 0.56 AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 pr... 24 4.0 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 23 7.0 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 27.1 bits (57), Expect = 0.56 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 517 RNIKRVKAVFDTLQLPMQLYTDTMPIQTINVHESHXFSHYRLQKTXNLC 663 R+I+R+ + D + +Y + +Q +N HE H F R Q C Sbjct: 92 RDIERLHTLND--RSADMIYQALVTLQHLNTHEEHNFHRVRRQVVAECC 138 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 27.1 bits (57), Expect = 0.56 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 517 RNIKRVKAVFDTLQLPMQLYTDTMPIQTINVHESHXFSHYRLQKTXNLC 663 R+I+R+ + D + +Y + +Q +N HE H F R Q C Sbjct: 92 RDIERLHTLND--RSADMIYQALVTLQHLNTHEEHNFHRVRRQVVAECC 138 >AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 59 PDMCHQVFGENENIFGYTD 115 PD+ HQV E ++IFG +D Sbjct: 55 PDIQHQVHQEIDSIFGGSD 73 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 571 LYTDTMPIQTINVHESHXFSHYRLQK 648 +Y + +Q +N HE H F H R+++ Sbjct: 108 IYQALVTLQHLNTHEEHNF-HRRVRR 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,942 Number of Sequences: 2352 Number of extensions: 14606 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -