BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120600.Seq (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 24 1.4 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 2.5 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 4.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 5.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 5.8 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/30 (30%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 389 LSCRRMY-THHTLLVYRVVAMIIQCVLSCL 303 L+C M TH T+ ++++ ++ C ++CL Sbjct: 195 LACGVMVVTHITMAHFKIIQVVPYCYINCL 224 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -2 Query: 601 FGFDETQFEILAAFTLKIVFHAGGGFVVVRLRCD 500 FG+D+ Q+ + + + F G V + L CD Sbjct: 239 FGYDKKQYIGVVVANVGVAFMINVGTVTLILSCD 272 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 385 PAAECTRTTPCW 350 P A CT +T CW Sbjct: 524 PWANCTASTRCW 535 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 378 QNVHAPHLVGVQSRRHDY 325 +N H PH + +SRR Y Sbjct: 600 RNFHGPHRLAARSRRCCY 617 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 378 QNVHAPHLVGVQSRRHDY 325 +N H PH + +SRR Y Sbjct: 492 RNFHGPHRLAARSRRCCY 509 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,436 Number of Sequences: 336 Number of extensions: 3505 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -