BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120600.Seq (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 9.7 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 9.7 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.7 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 302 PNTKGRTV*SWRRLCTPTRCG-ACTFCGRTMENCTRASRAT 421 P GR +W+RL + T CG G T+ C A+ AT Sbjct: 131 PYRAGRVGQTWQRLLSVTTCGLLLLLLGATV--CRGANGAT 169 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.7 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 302 PNTKGRTV*SWRRLCTPTRCG-ACTFCGRTMENCTRASRAT 421 P GR +W+RL + T CG G T+ C A+ AT Sbjct: 131 PYRAGRVGQTWQRLLSVTTCGLLLLLLGATV--CRGANGAT 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 767,558 Number of Sequences: 2352 Number of extensions: 15418 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -