BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120599.Seq (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 149 2e-38 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 24 1.5 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 24 1.5 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 4.7 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 4.7 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 4.7 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 4.7 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 4.7 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 4.7 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 6.2 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 6.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 6.2 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 8.2 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 149 bits (361), Expect = 2e-38 Identities = 70/86 (81%), Positives = 75/86 (87%) Frame = +3 Query: 255 NASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEEAIINKKRSQ 434 NASNNELVRTKTLVKNAIV +DATPFRQWYE HY LPLGRK+GAKLTEAEE ++NKKRS+ Sbjct: 84 NASNNELVRTKTLVKNAIVTIDATPFRQWYEGHYVLPLGRKRGAKLTEAEEEVLNKKRSK 143 Query: 435 KTARKYLARQRLAKVEGALEEQFHTG 512 K KY ARQR AKVE ALEEQF TG Sbjct: 144 KAEAKYKARQRFAKVEPALEEQFATG 169 Score = 131 bits (316), Expect = 7e-33 Identities = 58/67 (86%), Positives = 65/67 (97%) Frame = +1 Query: 52 GKRAPIRKKRKYELGRPAANTRLGPRRIHSVRSRGGNTEYRALRLDTGNFSWGSECSTRK 231 GKR PIRKKRK+ELGRPAANT+LGP+RIH+VR+RGGN +YRALRLDTGNFSWGSEC+TRK Sbjct: 16 GKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRLDTGNFSWGSECTTRK 75 Query: 232 TRIIDVV 252 TRIIDVV Sbjct: 76 TRIIDVV 82 Score = 79.4 bits (187), Expect = 3e-17 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +2 Query: 509 GRLLACVASRPGQCGRADGYILEGKELEFYLRKIKSKRAK 628 GR+LAC++SRPGQCGR DGYILEGKELEFY+R+IKSK+AK Sbjct: 169 GRVLACISSRPGQCGREDGYILEGKELEFYMRRIKSKKAK 208 Score = 39.1 bits (87), Expect = 4e-05 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 6 MGISRDHWHKRRATG 50 MGISRDHWHKRRATG Sbjct: 1 MGISRDHWHKRRATG 15 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 314 YNNCILDKGLCT 279 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 314 YNNCILDKGLCT 279 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 347 LVPLPEWSCIYYNNC 303 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 314 YNNCILDKGLCTHQ 273 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 191 VSRRSARYSVFPPRERTEWIRR 126 + RR++RY + PP+E RR Sbjct: 116 IIRRNSRYPLRPPQEVISHYRR 137 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 314 YNNCILDKGLCTHQ 273 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 347 LVPLPEWSCIYYNNC 303 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 347 LVPLPEWSCIYYNNC 303 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 347 LVPLPEWSCIYYNNC 303 L P P+WS Y +C Sbjct: 109 LQPYPDWSFAKYEDC 123 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 347 LVPLPEWSCIYYNNC 303 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 347 LVPLPEWSCIYYNNC 303 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 347 LVPLPEWSCIYYNNC 303 L P P+WS Y +C Sbjct: 110 LRPYPDWSFAKYEDC 124 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,308 Number of Sequences: 438 Number of extensions: 3728 Number of successful extensions: 22 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -