BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120598.Seq (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 33 0.18 SB_28145| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.5e-05) 32 0.42 SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 1775 Score = 33.5 bits (73), Expect = 0.18 Identities = 21/75 (28%), Positives = 33/75 (44%) Frame = +2 Query: 233 GQFAHRTRDNKLSQMYIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSS 412 G H + +L + +I K L+++ I K+ N GT+ + T DYG S N Sbjct: 1367 GNKYHSISERRLGKPHIGRKTLAVNKIDKDDDNDDGTDEVVKQTFDDYG--SRNEVVWHG 1424 Query: 413 NVTMTRGTANFDIKE 457 N R T ++E Sbjct: 1425 NRIQERSTKRAALEE 1439 >SB_28145| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.5e-05) Length = 340 Score = 32.3 bits (70), Expect = 0.42 Identities = 22/68 (32%), Positives = 33/68 (48%) Frame = -1 Query: 505 SFSGRYTFEYNKHGFKFLDIKVCGAARHGHITRCAGRVWRFNSIVVYGAQKNAVSAHFVG 326 S+ R +FE NK+ ++ K C G+I G + +VV G+ NA+ V Sbjct: 206 SYKFRLSFE-NKNCVDYITEKYCYPLEKGNIPIVLGGASYDSKLVVPGSYINALDFPSVK 264 Query: 325 ALFDYVVY 302 AL DY+ Y Sbjct: 265 ALADYIQY 272 >SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 598 APLVRTAAPC-WGRSSTQSCCRLRIATCHCPYSFSGRYTFEY 476 +P V ++PC +G + +SC C CP +F GR Y Sbjct: 113 SPAVCASSPCRYGGTCVRSCDDYEEYECFCPKNFIGRQCETY 154 >SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 195 SRLIPPIR-CSALNWATPRLRNLNLMHSSNRDKSVRAKRSI 76 S ++PP R S+ W PR RNL + S R K R +R++ Sbjct: 156 SVVLPPHRLASSTKWTRPR-RNLEVGDISTRQKWTRPRRNL 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,851,048 Number of Sequences: 59808 Number of extensions: 488278 Number of successful extensions: 1457 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1455 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -