BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120598.Seq (733 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X94216-1|CAA63907.1| 419|Homo sapiens VEGF-C protein. 36 0.20 U58111-1|AAB02909.1| 419|Homo sapiens FLT4 ligand DHM protein. 36 0.20 U43142-1|AAA85214.1| 419|Homo sapiens vascular endothelial grow... 36 0.20 CR541897-1|CAG46695.1| 419|Homo sapiens VEGFC protein. 36 0.20 BC063685-1|AAH63685.1| 419|Homo sapiens vascular endothelial gr... 36 0.20 BC035212-1|AAH35212.1| 419|Homo sapiens vascular endothelial gr... 36 0.20 BC141808-1|AAI41809.1| 446|Homo sapiens MGC34761 protein protein. 31 3.2 BC078143-1|AAH78143.1| 446|Homo sapiens secretory protein LOC34... 31 3.2 BC039068-1|AAH39068.1| 301|Homo sapiens MGC34761 protein protein. 31 3.2 AY358373-1|AAQ88739.1| 455|Homo sapiens LHPE306 protein. 31 3.2 AK074773-1|BAC11199.1| 446|Homo sapiens protein ( Homo sapiens ... 31 3.2 AF521893-1|AAP80866.1| 446|Homo sapiens unnamed secretory prote... 31 3.2 AF428259-1|AAP97299.1| 303|Homo sapiens hypothetical protein pr... 31 3.2 Y12864-1|CAA73371.1| 354|Homo sapiens growth factor FIGF protein. 31 4.3 Y12863-1|CAA73370.1| 354|Homo sapiens growth factor FIGF protein. 31 4.3 D89630-1|BAA24264.1| 354|Homo sapiens VEGF-D protein. 31 4.3 BC027948-1|AAH27948.1| 354|Homo sapiens c-fos induced growth fa... 31 4.3 AJ000185-1|CAA03942.1| 354|Homo sapiens vascular endothelial gr... 31 4.3 AF448856-1|AAP41924.1| 303|Homo sapiens hypothetical protein pr... 30 7.4 >X94216-1|CAA63907.1| 419|Homo sapiens VEGF-C protein. Length = 419 Score = 35.5 bits (78), Expect = 0.20 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N L C T LSK ++IT+PL KP NHT Sbjct: 161 RCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHT 207 >U58111-1|AAB02909.1| 419|Homo sapiens FLT4 ligand DHM protein. Length = 419 Score = 35.5 bits (78), Expect = 0.20 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N L C T LSK ++IT+PL KP NHT Sbjct: 161 RCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHT 207 >U43142-1|AAA85214.1| 419|Homo sapiens vascular endothelial growth factor related protein protein. Length = 419 Score = 35.5 bits (78), Expect = 0.20 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N L C T LSK ++IT+PL KP NHT Sbjct: 161 RCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHT 207 >CR541897-1|CAG46695.1| 419|Homo sapiens VEGFC protein. Length = 419 Score = 35.5 bits (78), Expect = 0.20 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N L C T LSK ++IT+PL KP NHT Sbjct: 161 RCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHT 207 >BC063685-1|AAH63685.1| 419|Homo sapiens vascular endothelial growth factor C protein. Length = 419 Score = 35.5 bits (78), Expect = 0.20 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N L C T LSK ++IT+PL KP NHT Sbjct: 161 RCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHT 207 >BC035212-1|AAH35212.1| 419|Homo sapiens vascular endothelial growth factor C protein. Length = 419 Score = 35.5 bits (78), Expect = 0.20 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N L C T LSK ++IT+PL KP NHT Sbjct: 161 RCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHT 207 >BC141808-1|AAI41809.1| 446|Homo sapiens MGC34761 protein protein. Length = 446 Score = 31.5 bits (68), Expect = 3.2 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 574 PCWGRSSTQSCCRLRIATCHC--PYSFSGRY 488 PC R S Q+ RL I+TCHC P ++GRY Sbjct: 231 PC--RMSCQNHGRLNISTCHCHCPPGYTGRY 259 >BC078143-1|AAH78143.1| 446|Homo sapiens secretory protein LOC348174 protein. Length = 446 Score = 31.5 bits (68), Expect = 3.2 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 574 PCWGRSSTQSCCRLRIATCHC--PYSFSGRY 488 PC R S Q+ RL I+TCHC P ++GRY Sbjct: 231 PC--RMSCQNHGRLNISTCHCHCPPGYTGRY 259 >BC039068-1|AAH39068.1| 301|Homo sapiens MGC34761 protein protein. Length = 301 Score = 31.5 bits (68), Expect = 3.2 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 574 PCWGRSSTQSCCRLRIATCHC--PYSFSGRY 488 PC R S Q+ RL I+TCHC P ++GRY Sbjct: 193 PC--RMSCQNHGRLNISTCHCHCPPGYTGRY 221 >AY358373-1|AAQ88739.1| 455|Homo sapiens LHPE306 protein. Length = 455 Score = 31.5 bits (68), Expect = 3.2 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 574 PCWGRSSTQSCCRLRIATCHC--PYSFSGRY 488 PC R S Q+ RL I+TCHC P ++GRY Sbjct: 231 PC--RMSCQNHGRLNISTCHCHCPPGYTGRY 259 >AK074773-1|BAC11199.1| 446|Homo sapiens protein ( Homo sapiens cDNA FLJ90292 fis, clone NT2RP1001563, highly similar to Secretory protein LOC348174. ). Length = 446 Score = 31.5 bits (68), Expect = 3.2 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 574 PCWGRSSTQSCCRLRIATCHC--PYSFSGRY 488 PC R S Q+ RL I+TCHC P ++GRY Sbjct: 231 PC--RMSCQNHGRLNISTCHCHCPPGYTGRY 259 >AF521893-1|AAP80866.1| 446|Homo sapiens unnamed secretory protein protein. Length = 446 Score = 31.5 bits (68), Expect = 3.2 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 574 PCWGRSSTQSCCRLRIATCHC--PYSFSGRY 488 PC R S Q+ RL I+TCHC P ++GRY Sbjct: 231 PC--RMSCQNHGRLNISTCHCHCPPGYTGRY 259 >AF428259-1|AAP97299.1| 303|Homo sapiens hypothetical protein protein. Length = 303 Score = 31.5 bits (68), Expect = 3.2 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -1 Query: 574 PCWGRSSTQSCCRLRIATCHC--PYSFSGRY 488 PC R S Q+ RL I+TCHC P ++GRY Sbjct: 231 PC--RMSCQNHGRLNISTCHCHCPPGYTGRY 259 >Y12864-1|CAA73371.1| 354|Homo sapiens growth factor FIGF protein. Length = 354 Score = 31.1 bits (67), Expect = 4.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N +L C T +SK ++I++PL + + K NHT Sbjct: 141 RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHT 187 >Y12863-1|CAA73370.1| 354|Homo sapiens growth factor FIGF protein. Length = 354 Score = 31.1 bits (67), Expect = 4.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N +L C T +SK ++I++PL + + K NHT Sbjct: 141 RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHT 187 >D89630-1|BAA24264.1| 354|Homo sapiens VEGF-D protein. Length = 354 Score = 31.1 bits (67), Expect = 4.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N +L C T +SK ++I++PL + + K NHT Sbjct: 141 RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHT 187 >BC027948-1|AAH27948.1| 354|Homo sapiens c-fos induced growth factor (vascular endothelial growth factor D) protein. Length = 354 Score = 31.1 bits (67), Expect = 4.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N +L C T +SK ++I++PL + + K NHT Sbjct: 141 RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHT 187 >AJ000185-1|CAA03942.1| 354|Homo sapiens vascular endothelial growth factor D protein. Length = 354 Score = 31.1 bits (67), Expect = 4.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 593 RCANCANPTALWCTR-KTRQLSKFYWKITLPLLMLTKPPISKTINHT 730 RC C N +L C T +SK ++I++PL + + K NHT Sbjct: 141 RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHT 187 >AF448856-1|AAP41924.1| 303|Homo sapiens hypothetical protein protein. Length = 303 Score = 30.3 bits (65), Expect = 7.4 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -1 Query: 562 RSSTQSCCRLRIAT--CHCPYSFSGRY 488 R S Q+ RL I+T CHCP ++GRY Sbjct: 233 RMSCQNHGRLNISTCHCHCPPGYTGRY 259 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,420,793 Number of Sequences: 237096 Number of extensions: 2236099 Number of successful extensions: 16398 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 16130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16390 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -