BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120594.Seq (772 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z31590-7|CAA83463.1| 361|Caenorhabditis elegans Hypothetical pr... 29 3.7 AF003740-9|AAC48140.1| 852|Caenorhabditis elegans Hypothetical ... 28 6.4 >Z31590-7|CAA83463.1| 361|Caenorhabditis elegans Hypothetical protein R01H10.6 protein. Length = 361 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +3 Query: 309 IKQHSNKQGAKCLRNATNLRLVYHSARRTTTKPPPAWNTILSVNAASISNCVS 467 ++ G + TNLRL++H+A WN I V + ++ V+ Sbjct: 39 VEDTKGNNGDRGTMRVTNLRLIWHAASMPRINITIGWNAITGVQSKQTTSLVT 91 >AF003740-9|AAC48140.1| 852|Caenorhabditis elegans Hypothetical protein C41D11.6 protein. Length = 852 Score = 28.3 bits (60), Expect = 6.4 Identities = 19/57 (33%), Positives = 26/57 (45%) Frame = +2 Query: 470 KAKPLLLHKFLLAISCKHEFGRAILSVGQPRKGGIHPVEIGAQR*YHQRTATILASP 640 +AKP +L + I + F + SV +P G HP I A R H +L SP Sbjct: 706 EAKPEVLTEDDFPILWREVFTEVVQSVNRPNVRGTHPAIIDAAR--HLNAHGLLPSP 760 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,724,200 Number of Sequences: 27780 Number of extensions: 342488 Number of successful extensions: 924 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -