BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120594.Seq (772 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43210.1 68418.m05280 endo/excinuclease amino terminal domain... 29 3.4 At4g00330.1 68417.m00042 protein kinase family protein contains ... 28 7.9 >At5g43210.1 68418.m05280 endo/excinuclease amino terminal domain-containing protein contains Pfam domain PF01541: Endo/excinuclease amino terminal domain Length = 170 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = +3 Query: 270 KLYTGITSNLNRRIKQHSN--KQGAK 341 K Y GIT++ +RR+KQH+ + GAK Sbjct: 67 KTYVGITTDFSRRLKQHNGEIRGGAK 92 >At4g00330.1 68417.m00042 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 411 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -3 Query: 629 KLLRFAGDIIVERQFQRDVFHLFVVAQPIVWHVQIHVYNLLLTEIYATKV 480 K L A + + + +L + QP + H I N+LLTE Y KV Sbjct: 214 KTLDMATRLDIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKV 263 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,521,159 Number of Sequences: 28952 Number of extensions: 309394 Number of successful extensions: 749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -