BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120593.Seq (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 6.3 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.3 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.4 bits (48), Expect = 6.3 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 477 QSRKTKIRRACPALLDRWCT*SCRWPAPTPRYFYRARDT 361 +S TK+ C R S R P+P P +Y AR+T Sbjct: 418 RSTSTKLSN-CSMRTIRTTVRSTRAPSPGPIVYYPARET 455 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 6.3 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 Query: 161 TPVSSCFTLKAAPLLLLYGTSCWSSPLSTLSRFGWLSSLLESPILR 24 TP +S K LLL +GT +SP S +S L ES R Sbjct: 1404 TPKTSLMDFKK--LLLAHGTKTHASPGSKMSAVEMLKKSKESAATR 1447 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,012 Number of Sequences: 2352 Number of extensions: 17188 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -