BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120593.Seq (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g37280.1 68415.m04573 ABC transporter family protein similar ... 30 1.5 At3g53480.1 68416.m05904 ABC transporter family protein PDR5-lik... 29 2.0 At5g47690.1 68418.m05887 expressed protein 28 4.7 At5g10020.1 68418.m01161 leucine-rich repeat transmembrane prote... 28 6.2 At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative ... 28 6.2 At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOA... 27 8.2 >At2g37280.1 68415.m04573 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1413 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 512 FFSIQYGDIHKHNNIFG 562 FFS QYGDIH+ N FG Sbjct: 1347 FFSSQYGDIHQKINAFG 1363 >At3g53480.1 68416.m05904 ABC transporter family protein PDR5-like ABC transporter, Spirodela polyrrhiza, EMBL:Z70524 Length = 1450 Score = 29.5 bits (63), Expect = 2.0 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 512 FFSIQYGDIHKHNNIFG 562 F S QYGDIH+ N+FG Sbjct: 1384 FISSQYGDIHEEINVFG 1400 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 22 KRKIGDSSSDDNQPKRERVESGEDQQLVPYN-NNNGAAFNVKHDE 153 KR +GD++S + PKR R SG PY +N+G +K E Sbjct: 1227 KRNVGDATSVVSVPKRRRSSSGHS----PYKFSNSGPKVQLKASE 1267 >At5g10020.1 68418.m01161 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase ERECTA, Arabidopsis thaliana, EMBL:AC004484 Length = 1048 Score = 27.9 bits (59), Expect = 6.2 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = -1 Query: 415 VLPLAGSNTTIFLSGSGYNLSSHSCKLFKLASRQNSFFKNLPS--KQLQFSIEKLPVSH* 242 VL L+ +N LSGS N +S +L L+ R NS +LPS QFS+ L + Sbjct: 368 VLDLSSNN----LSGSLPNFTSAFSRLSVLSIRNNSVSGSLPSLWGDSQFSVIDLSSNKF 423 Query: 241 SPFAPAT 221 S F P + Sbjct: 424 SGFIPVS 430 >At1g76880.1 68414.m08946 trihelix DNA-binding protein, putative similar to DNA-binding protein DF1 [Pisum sativum] GI:13646986 Length = 603 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 49 DDNQPKRERVESGEDQQLVPYNNNNGAAFN 138 D+++ + E G + +LVP NNNN N Sbjct: 572 DEDEEEENEEEEGGEFELVPSNNNNNKTTN 601 >At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOAT) family protein / wax synthase-related similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 341 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 95 WSSPLSTLSRFGWLSSLLESPILRLVAMLP 6 W S L +LS ++SS L +LRL+++LP Sbjct: 12 WISALISLSYCYYISSKLSKGVLRLLSILP 41 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,334,192 Number of Sequences: 28952 Number of extensions: 340593 Number of successful extensions: 1003 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1003 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -