BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120591.Seq (857 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.11c |elg1||DNA replication factor C complex subunit Elg1... 27 3.4 SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom... 26 6.0 SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosa... 26 7.9 >SPBC947.11c |elg1||DNA replication factor C complex subunit Elg1|Schizosaccharomyces pombe|chr 2|||Manual Length = 920 Score = 27.1 bits (57), Expect = 3.4 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 46 CYQSGCTQKIA--LGCCRSQIPASTRIPPRSS 135 C S C KIA L CR P S+ +PP SS Sbjct: 338 CAFSQCLSKIADWLRSCRLTKPESSSVPPSSS 369 >SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1562 Score = 26.2 bits (55), Expect = 6.0 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 393 NDLRDRIKSK-VDEQFDQLEREYSDKIDGFHDNIQYFKD 280 ND R ++S + E+ Q+ +SDK DNI F++ Sbjct: 660 NDTRCEVRSSSILEELGQVTHVFSDKTGTLTDNIMLFRN 698 >SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 25.8 bits (54), Expect = 7.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 378 RIKSKVDEQFDQLEREYSDKIDGFHDNI 295 R + K D ++ LEREY D F +++ Sbjct: 285 RAQLKKDPNYESLEREYQKACDDFENSL 312 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,516,020 Number of Sequences: 5004 Number of extensions: 73489 Number of successful extensions: 209 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 209 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -