BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120590.Seq (723 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 24 1.1 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 4.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.8 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.6 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 7.6 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 555 RRDAETARQDCENARRKTAQLANRMAD 635 RR+ E A++D + + T + N +AD Sbjct: 91 RREVEKAKRDLSSVHKTTLTIENLLAD 117 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = +3 Query: 93 TCSVMSSQSDLWPR-TSP 143 TCS++ + LWP+ T P Sbjct: 81 TCSMLCGSTQLWPQPTGP 98 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 291 HSAHYQIWRDSTDNE 335 H Y IW D +DN+ Sbjct: 30 HQQIYGIWADDSDND 44 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 7.6 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = -3 Query: 580 CRAVSASRRATIISLANKMSDRLLRQICVGHRQFLRQIVNFGNNIICIHFNG 425 C+ V A I AN+M Q+C G + + + N + +H++G Sbjct: 152 CQCVLADGVERGILTANRMIPGPSIQVCEGDKVVIDVENHIEGNEVTLHWHG 203 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 7.6 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = -3 Query: 580 CRAVSASRRATIISLANKMSDRLLRQICVGHRQFLRQIVNFGNNIICIHFNG 425 C+ V A I AN+M Q+C G + + + N + +H++G Sbjct: 152 CQCVLADGVERGILTANRMIPGPSIQVCEGDKVVIDVENHIEGNEVTLHWHG 203 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 593 RAPQNGAAGQPHGGHC 640 + PQ G A QP G C Sbjct: 35 QVPQGGGAVQPDPGSC 50 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,838 Number of Sequences: 336 Number of extensions: 4001 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -