BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120590.Seq (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 24 1.7 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 8.9 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 176 IRVHVDGKYKSTFEHADQIQHHAPDSGQSR 265 + V+ DG Y + FE ++ I H +SGQ + Sbjct: 34 LEVNFDGNYINNFETSNGISHQ--ESGQPK 61 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 197 CRRRGHVLPVHNLHILNCWRCPWPQ 123 CR + HV +H+ ++ +R P Q Sbjct: 148 CRPKIHVFSLHDNKLITMYRFPQNQ 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,844 Number of Sequences: 438 Number of extensions: 4557 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -