BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120589.Seq (773 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 31 0.009 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 31 0.009 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 30 0.028 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 29 0.036 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 28 0.11 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 27 0.26 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 27 0.26 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 25 0.59 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 25 0.59 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 25 0.59 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 24 1.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 24 1.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.2 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 23 3.2 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 4.2 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 5.5 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 7.3 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 7.3 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 7.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.6 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 31.5 bits (68), Expect = 0.009 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = +3 Query: 186 LQSSDFSKSSLKKAANEEAFDQFKKKRKKFPIT 284 L SSD SKS LKK +++ FDQ K K+ F T Sbjct: 1 LSSSD-SKSLLKKYLSKDVFDQLKTKKTSFDST 32 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 31.5 bits (68), Expect = 0.009 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = +3 Query: 186 LQSSDFSKSSLKKAANEEAFDQFKKKRKKFPIT 284 L SSD SKS LKK +++ FDQ K K+ F T Sbjct: 17 LSSSD-SKSLLKKYLSKDVFDQLKTKKTSFDST 48 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 29.9 bits (64), Expect = 0.028 Identities = 15/55 (27%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +1 Query: 154 QQKKY*TKLRTYK--VQTFQKVV*RKLRMKRPLTSLKRKEKNFQSRRQYRNFKER 312 + ++Y K R Y+ +K++ + KR S +R++K++++ R+YR ++ER Sbjct: 8 RNREYKEKDRRYEKLYNEKEKLLEERTSRKRYSRSREREQKSYKNERKYRKYRER 62 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.036 Identities = 11/36 (30%), Positives = 25/36 (69%) Frame = +1 Query: 205 QKVV*RKLRMKRPLTSLKRKEKNFQSRRQYRNFKER 312 +K++ + KR S +R++K++++ R+YR ++ER Sbjct: 27 EKLLEERTSRKRYSRSREREQKSYKNERKYRKYRER 62 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 27.9 bits (59), Expect = 0.11 Identities = 10/36 (27%), Positives = 24/36 (66%) Frame = +1 Query: 205 QKVV*RKLRMKRPLTSLKRKEKNFQSRRQYRNFKER 312 +K++ + KR S +R++ ++++ R+YR ++ER Sbjct: 260 EKLLEERTSRKRYSRSREREQNSYKNEREYRKYRER 295 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 26.6 bits (56), Expect = 0.26 Identities = 9/36 (25%), Positives = 24/36 (66%) Frame = +1 Query: 205 QKVV*RKLRMKRPLTSLKRKEKNFQSRRQYRNFKER 312 +K++ + KR S +R++ ++++ ++YR ++ER Sbjct: 27 EKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRER 62 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 26.6 bits (56), Expect = 0.26 Identities = 9/36 (25%), Positives = 24/36 (66%) Frame = +1 Query: 205 QKVV*RKLRMKRPLTSLKRKEKNFQSRRQYRNFKER 312 +K++ + KR S +R++ ++++ ++YR ++ER Sbjct: 27 EKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRER 62 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 25.4 bits (53), Expect = 0.59 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +2 Query: 359 KPWTKTEQELLEQAIKTFPVNTPERWEKISD 451 K T ++E++++ IK N PE W+ +++ Sbjct: 77 KKCTDKQREVIKKVIKFLVENKPELWDSLAN 107 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 25.4 bits (53), Expect = 0.59 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +2 Query: 359 KPWTKTEQELLEQAIKTFPVNTPERWEKISD 451 K T ++E++++ IK N PE W+ +++ Sbjct: 77 KKCTDKQREVIKKVIKFLVENKPELWDSLAN 107 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 25.4 bits (53), Expect = 0.59 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +2 Query: 359 KPWTKTEQELLEQAIKTFPVNTPERWEKISD 451 K T ++E++++ IK N PE W+ +++ Sbjct: 77 KKCTDKQREVIKKVIKFLVENKPELWDSLAN 107 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +2 Query: 335 TAEIKPEEKPWTKTEQELLEQAIKTFPVNTPERW 436 T + + K T+ +++ L++ + F N PE+W Sbjct: 68 TEAFQTQCKKCTEIQKQNLDKLAEWFTTNEPEKW 101 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +2 Query: 335 TAEIKPEEKPWTKTEQELLEQAIKTFPVNTPERW 436 T + + K T+ +++ L++ + F N PE+W Sbjct: 68 TEAFQTQCKKCTEIQKQNLDKLAEWFTTNEPEKW 101 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 3.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 449 DCIPNRSKKDCMKRYKE 499 DC +S+ DC+K KE Sbjct: 416 DCTLEKSQDDCLKAIKE 432 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 3.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 449 DCIPNRSKKDCMKRYKE 499 DC +S+ DC+K KE Sbjct: 416 DCTLEKSQDDCLKAIKE 432 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 3.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 449 DCIPNRSKKDCMKRYKE 499 DC +S+ DC+K KE Sbjct: 416 DCTLEKSQDDCLKAIKE 432 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 648 ISI*NNLVYILQHEGNGLI 592 I + N LVY+ H+G+ LI Sbjct: 194 IDLANTLVYMADHKGDALI 212 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 510 YSTNSLYLFMQSFFDRFGIQSEIFSHRSGVFTGNV 406 YS S+ L FFD F + +I ++ +F N+ Sbjct: 297 YSVTSVRLISSGFFDNF-VTVQIQPLKNELFNANI 330 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 636 NNLVYILQHEGNGLI-YRHS 580 N +VYI +G GLI Y++S Sbjct: 203 NTMVYIADEKGEGLIMYQNS 222 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 636 NNLVYILQHEGNGLIYRHS 580 + +VYI +G GLI H+ Sbjct: 200 DTMVYIADEKGEGLIVYHN 218 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 636 NNLVYILQHEGNGLIYRHS 580 + +VYI +G GLI H+ Sbjct: 200 DTMVYIADEKGEGLIVYHN 218 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 636 NNLVYILQHEGNGLIYRHS 580 + +VYI +G GLI H+ Sbjct: 200 DTMVYIADEKGEGLIVYHN 218 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 295 GIVYVIGNFFLFFLNW 248 GI+ V +F F+L W Sbjct: 311 GIILVTSSFITFWLEW 326 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 295 GIVYVIGNFFLFFLNW 248 GI+ V +F F+L W Sbjct: 280 GIILVTSSFITFWLEW 295 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 295 GIVYVIGNFFLFFLNW 248 GI+ V +F F+L W Sbjct: 331 GIILVTSSFITFWLEW 346 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 295 GIVYVIGNFFLFFLNW 248 GI+ V +F F+L W Sbjct: 280 GIILVTSSFITFWLEW 295 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 411 NVLIACSNNSCSVLVQG 361 + LI C+ NSC+ ++ G Sbjct: 314 DALIVCTVNSCTSMLSG 330 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 411 NVLIACSNNSCSVLVQG 361 + LI C+ NSC+ ++ G Sbjct: 367 DALIVCTVNSCTSMLSG 383 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,072 Number of Sequences: 438 Number of extensions: 4558 Number of successful extensions: 29 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -