BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120586.Seq (806 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 27 2.4 SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce... 27 3.1 SPAC1782.04 |cox24||mitochondrial mRNA processing protein Cox24 ... 26 7.2 SPAC12B10.12c |rhp41|rhp4a|DNA repair protein Rhp41 |Schizosacch... 25 9.6 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 27.5 bits (58), Expect = 2.4 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 240 RRRLQSALKCIDFDYYGLCSKKMFCNLQTN-LQKCVDQHYAELDVLTRQIYMSNPLVMLK 416 R L+ L +D + LC K + L + LQK + ELD L R++Y +P + + Sbjct: 221 RSYLEFILSNLDLECLTLCLKIIKGILTLDELQKAIKLKQTELDKLERRLYRPSPQNIFE 280 Query: 417 CYQ 425 ++ Sbjct: 281 IFE 283 >SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1261 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +3 Query: 354 YAELDVL-TRQIYMSNPLV--MLKCYQNGAYRLTVKSI 458 YA +V+ T + S ++ +LKCY NG Y+ + K++ Sbjct: 671 YAAFNVVQTEGTFTSKVILTDLLKCYSNGTYKASFKNV 708 >SPAC1782.04 |cox24||mitochondrial mRNA processing protein Cox24 |Schizosaccharomyces pombe|chr 1|||Manual Length = 175 Score = 25.8 bits (54), Expect = 7.2 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -1 Query: 257 AL*SSSSIWHVTAAPPVNT--NKPPFSQTT-ASKQSLINANF 141 +L S IWHV+A+P V + N P T+ S + + ANF Sbjct: 18 SLRSPIPIWHVSASPEVGSKYNLPTVPTTSHVSYRQIAKANF 59 >SPAC12B10.12c |rhp41|rhp4a|DNA repair protein Rhp41 |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 25.4 bits (53), Expect = 9.6 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = +3 Query: 711 GVVVATRFERPVNVLAEDIFHQQ 779 GVVV+ R+E ++++AE+I ++ Sbjct: 582 GVVVSKRYEEAIDLIAEEIDQEE 604 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,154,419 Number of Sequences: 5004 Number of extensions: 62966 Number of successful extensions: 177 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 392429240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -