BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120586.Seq (806 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20220.1 68417.m02955 hypothetical protein 28 6.3 At2g02680.1 68415.m00207 DC1 domain-containing protein contains ... 28 8.4 >At4g20220.1 68417.m02955 hypothetical protein Length = 158 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 782 NLLVKNVFSKHINWSFKTRCNDDTN 708 NL+ + V+ INW FKT + TN Sbjct: 116 NLISERVYLPEINWKFKTEPHTSTN 140 >At2g02680.1 68415.m00207 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 649 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 528 CKSNQINSSLYCVFMHFIWRFKCKSI*PLVYRLRFDN 418 CKS + N L C+ FI F+C ++ P V R + D+ Sbjct: 501 CKSTKENQVLNCIEGDFIICFECATL-PYVIRYKHDD 536 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,126,660 Number of Sequences: 28952 Number of extensions: 319114 Number of successful extensions: 777 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -