BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120584X.Seq (544 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41344-1|AAC18782.1| 382|Homo sapiens prolargin protein. 31 3.4 U29089-1|AAC50230.1| 382|Homo sapiens proline- arginine-rich en... 31 3.4 CR542270-1|CAG47066.1| 382|Homo sapiens PRELP protein. 31 3.4 CR541787-1|CAG46586.1| 382|Homo sapiens PRELP protein. 31 3.4 BC032498-1|AAH32498.1| 382|Homo sapiens proline/arginine-rich e... 31 3.4 AL391817-1|CAI17033.1| 382|Homo sapiens proline/arginine-rich e... 31 3.4 >U41344-1|AAC18782.1| 382|Homo sapiens prolargin protein. Length = 382 Score = 30.7 bits (66), Expect = 3.4 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 331 TSSHCFILLSSLLSV*RNKYFKRSPSLAFIQMSKEFENVIRLYKNFSKVPSIVGAHLS 504 T+ H L S+ + N YFK P+LAFI+++ L KN + +++ HLS Sbjct: 242 TAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLS 299 >U29089-1|AAC50230.1| 382|Homo sapiens proline- arginine-rich end leucine-rich repeat protein protein. Length = 382 Score = 30.7 bits (66), Expect = 3.4 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 331 TSSHCFILLSSLLSV*RNKYFKRSPSLAFIQMSKEFENVIRLYKNFSKVPSIVGAHLS 504 T+ H L S+ + N YFK P+LAFI+++ L KN + +++ HLS Sbjct: 242 TAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLS 299 >CR542270-1|CAG47066.1| 382|Homo sapiens PRELP protein. Length = 382 Score = 30.7 bits (66), Expect = 3.4 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 331 TSSHCFILLSSLLSV*RNKYFKRSPSLAFIQMSKEFENVIRLYKNFSKVPSIVGAHLS 504 T+ H L S+ + N YFK P+LAFI+++ L KN + +++ HLS Sbjct: 242 TAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLS 299 >CR541787-1|CAG46586.1| 382|Homo sapiens PRELP protein. Length = 382 Score = 30.7 bits (66), Expect = 3.4 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 331 TSSHCFILLSSLLSV*RNKYFKRSPSLAFIQMSKEFENVIRLYKNFSKVPSIVGAHLS 504 T+ H L S+ + N YFK P+LAFI+++ L KN + +++ HLS Sbjct: 242 TAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLS 299 >BC032498-1|AAH32498.1| 382|Homo sapiens proline/arginine-rich end leucine-rich repeat protein protein. Length = 382 Score = 30.7 bits (66), Expect = 3.4 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 331 TSSHCFILLSSLLSV*RNKYFKRSPSLAFIQMSKEFENVIRLYKNFSKVPSIVGAHLS 504 T+ H L S+ + N YFK P+LAFI+++ L KN + +++ HLS Sbjct: 242 TAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLS 299 >AL391817-1|CAI17033.1| 382|Homo sapiens proline/arginine-rich end leucine-rich repeat protein protein. Length = 382 Score = 30.7 bits (66), Expect = 3.4 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 331 TSSHCFILLSSLLSV*RNKYFKRSPSLAFIQMSKEFENVIRLYKNFSKVPSIVGAHLS 504 T+ H L S+ + N YFK P+LAFI+++ L KN + +++ HLS Sbjct: 242 TAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLS 299 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,728,679 Number of Sequences: 237096 Number of extensions: 1119398 Number of successful extensions: 4154 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4154 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5308067764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -