BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120581.Seq (801 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC070066-1|AAH70066.1| 1087|Homo sapiens ANLN protein protein. 30 8.5 AF273437-1|AAF75796.1| 1125|Homo sapiens actin binding protein a... 30 8.5 >BC070066-1|AAH70066.1| 1087|Homo sapiens ANLN protein protein. Length = 1087 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 Query: 635 PDLLDLLNEYMTKSSIMKIITKFVIEENPAMNGEMSREIILDSYSVD 775 P+LL K+ + K I K + + GE+SREI L S S D Sbjct: 314 PELLPKTPISPLKTGVSKPIVKSTLSQTVPSKGELSREICLQSQSKD 360 >AF273437-1|AAF75796.1| 1125|Homo sapiens actin binding protein anillin protein. Length = 1125 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 Query: 635 PDLLDLLNEYMTKSSIMKIITKFVIEENPAMNGEMSREIILDSYSVD 775 P+LL K+ + K I K + + GE+SREI L S S D Sbjct: 315 PELLPKTPISPLKTGVSKPIVKSTLSQTVPSKGELSREICLQSQSKD 361 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,744,644 Number of Sequences: 237096 Number of extensions: 2290741 Number of successful extensions: 4836 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4836 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9869080686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -