BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120578X.Seq (584 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 27 2.7 SPAC12B10.06c |||DUF339 family protein|Schizosaccharomyces pombe... 25 6.2 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 26.6 bits (56), Expect = 2.7 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 176 FNINAFVPSLHCFHRFYSDFGNQVSLYSL 262 FN N VPS F R FG + S Y L Sbjct: 575 FNANGKVPSTDEFKRLLLPFGERTSAYDL 603 >SPAC12B10.06c |||DUF339 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 139 Score = 25.4 bits (53), Expect = 6.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 578 LNYEHCSYHLKQVNDQY*KKLIITRSLSFLSRKYCILK 465 L +EH LK+VN Y + + L + SRK IL+ Sbjct: 26 LRFEHTKGDLKRVNRSYETRDAMLARLKYQSRKRGILE 63 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,213,619 Number of Sequences: 5004 Number of extensions: 43059 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -