BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120578X.Seq (584 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0934 - 33167569-33167720,33167820-33168069 29 2.7 11_02_0146 + 8779249-8780130,8780815-8780970,8781070-8781265,878... 28 6.3 >01_06_0934 - 33167569-33167720,33167820-33168069 Length = 133 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +1 Query: 343 KNDSELQN*SK*ICILENKKTVLRYYDFVVIQKN*LNGFSNLSIQYFRDKNDKL 504 +N SE N S C+L K+ V Y+D K L+G+ I R +N KL Sbjct: 74 ENSSEFSNGSGLRCLLLEKQEVFMYFDNDACSKK-LHGWPGALIDNCRGRNIKL 126 >11_02_0146 + 8779249-8780130,8780815-8780970,8781070-8781265, 8781574-8781599 Length = 419 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 206 HCFHRFYSDFGNQVSLYSLCFFFH 277 +C H +Y D G+QVS C F+ Sbjct: 244 YCLHSYYGDCGDQVSCGKYCTRFY 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,213,014 Number of Sequences: 37544 Number of extensions: 203045 Number of successful extensions: 327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -