BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120578X.Seq (584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 4.2 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 24 4.2 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 4.2 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -1 Query: 461 LNPFNQFFCMTTKS*YLRTVFLFSKIQ 381 L+P+ +F C++T+ Y + L+ KI+ Sbjct: 252 LSPYLRFGCLSTRLFYYQLTDLYKKIK 278 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 23.8 bits (49), Expect = 4.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 353 QNYKISLNKSVF*RIKKQSLDIMISSSYKRID*MDLV 463 +++K +N S+F R KKQ D ++ D +DLV Sbjct: 639 KSHKEQVNCSIFSRKKKQCRDKYLAKHNAVFDQLDLV 675 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 532,844 Number of Sequences: 2352 Number of extensions: 9617 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -