BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120576.Seq (856 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF492764-1|AAM11673.1| 417|Drosophila melanogaster gag protein ... 29 8.1 >AF492764-1|AAM11673.1| 417|Drosophila melanogaster gag protein protein. Length = 417 Score = 29.1 bits (62), Expect = 8.1 Identities = 18/62 (29%), Positives = 25/62 (40%) Frame = +2 Query: 26 NRYQPGYQLSNNRFVSTSDINRITRNNDVPNIRNVFQGISDPQINSLRQLRRMDNVPDFH 205 NR+ P + N F T + NN V R G + I LR + N P++ Sbjct: 288 NRFGPNQTYTPNNFPPTGNTQT---NNPVKRQRPSDSGQTKMSIEELRYQEMVSNQPEYP 344 Query: 206 YH 211 YH Sbjct: 345 YH 346 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,438,050 Number of Sequences: 53049 Number of extensions: 941666 Number of successful extensions: 2730 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2730 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4106450400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -