BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120576.Seq (856 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 4.7 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 4.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 4.7 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 8.3 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 8.3 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 8.3 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 241 TKLPRTNVRTPEVFKTHCSKTP 306 TKLP T++ V K H +K P Sbjct: 230 TKLPDTSMAKSFVRKVHATKPP 251 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 424 IEPAEVIMCKVETPEKTSSPVCYCSALVARP 516 +EP+E+ K+ET + P Y + P Sbjct: 571 LEPSEIFYEKIETSLNSDKPFTYNERIFGFP 601 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 424 IEPAEVIMCKVETPEKTSSPVCYCSALVARP 516 +EP+E+ K+ET + P Y + P Sbjct: 571 LEPSEIFYEKIETSLNSDKPFTYNERIFGFP 601 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.8 bits (44), Expect = 8.3 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = -1 Query: 841 WALFCCGCRHYCWTICRLNLL 779 W + C + W +C L LL Sbjct: 79 WVIHPCSSFRFYWDLCMLLLL 99 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 8.3 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = -1 Query: 841 WALFCCGCRHYCWTICRLNLL 779 W + C + W +C L LL Sbjct: 79 WVIHPCSSFRFYWDLCMLLLL 99 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 8.3 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = -1 Query: 841 WALFCCGCRHYCWTICRLNLL 779 W + C + W +C L LL Sbjct: 79 WVIHPCSSFRFYWDLCMLLLL 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 243,628 Number of Sequences: 438 Number of extensions: 5449 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -