BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120570.Seq (781 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.90 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 3.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.90 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 385 GNIQLKKMYDRGLLVGRENTSRMEYKPEPEPTDP 486 G+ L + +RGL + +N SR + PEP P Sbjct: 979 GSFPLLRSLNRGLGLIPDNPSREDCTKPPEPVTP 1012 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 525 TPTMDGKVPIYDFDSWSKHHYSDVFAKQKYDKE 623 T TM+ K +Y+F ++ H A +D E Sbjct: 297 TATMEEKQELYEFSNFVSQHLPKFSAANFFDIE 329 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 192 FIDNLLPHLNFVPATMMCLE 251 F +++ P+L FVP +M L+ Sbjct: 191 FAESIPPYLFFVPPPLMFLQ 210 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 192 FIDNLLPHLNFVPATMMCLE 251 F +++ P+L FVP +M L+ Sbjct: 424 FAESIPPYLFFVPPPLMFLQ 443 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 192 FIDNLLPHLNFVPATMMCLE 251 F +++ P+L FVP +M L+ Sbjct: 424 FAESIPPYLFFVPPPLMFLQ 443 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,708 Number of Sequences: 336 Number of extensions: 4577 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -