BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120570.Seq (781 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 70 2e-12 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 56 4e-08 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 54 1e-07 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 54 1e-07 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 54 1e-07 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 51 1e-06 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 49 5e-06 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 48 6e-06 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 43 2e-04 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 43 2e-04 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 43 3e-04 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 43 3e-04 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 42 7e-04 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 38 0.009 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 33 0.34 SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_30672| Best HMM Match : Colipase (HMM E-Value=6.5) 31 1.4 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 30 1.8 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 30 2.4 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 30 2.4 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 29 3.2 SB_56284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) 29 5.6 SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) 28 7.4 SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 28 7.4 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 28 7.4 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 70.1 bits (164), Expect = 2e-12 Identities = 32/59 (54%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDKSK-DEASIKKFRAITEAYEVLGNIQLKKMYDRGLLV 429 PKA+Q+ IK AYYKLS HHPD+ + + + F+ I EAY VLGN++ +K YDRGL+V Sbjct: 81 PKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRKQYDRGLIV 139 Score = 36.7 bits (81), Expect = 0.021 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +3 Query: 552 IYDFDSWSKHHYSDVFAKQKYDKEMVRNSQEKQQ 653 IYDFD W+K HY + +++ DK+ R+ + +Q+ Sbjct: 161 IYDFDEWTKQHYYEALKRRQRDKKERRDEKFEQE 194 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 70.1 bits (164), Expect = 2e-12 Identities = 32/59 (54%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDKSK-DEASIKKFRAITEAYEVLGNIQLKKMYDRGLLV 429 PKA+Q+ IK AYYKLS HHPD+ + + + F+ I EAY VLGN++ +K YDRGL+V Sbjct: 81 PKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRKQYDRGLIV 139 Score = 35.1 bits (77), Expect = 0.064 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +3 Query: 552 IYDFDSWSKHHYSDVFAKQKYDKEMVRNSQEKQQKI 659 IYDFD W+K HY + +++ DK+ R+ + ++ I Sbjct: 161 IYDFDEWTKQHYYEALKRRQRDKKERRDEKFDKRHI 196 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 61.3 bits (142), Expect = 9e-10 Identities = 25/53 (47%), Positives = 40/53 (75%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYD 414 P A Q +IK AY++L+K +HPD +KD+++ +KF+ ++EAYEVL + +K YD Sbjct: 68 PNANQKEIKKAYFELAKKYHPDTNKDKSASEKFQEVSEAYEVLSDDGKRKAYD 120 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 55.6 bits (128), Expect = 4e-08 Identities = 21/54 (38%), Positives = 37/54 (68%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 P ATQ +IK+AYY+LS+++HPD + + ++F +T AY L ++ ++ YD+ Sbjct: 60 PTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREYDK 113 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 55.6 bits (128), Expect = 4e-08 Identities = 21/54 (38%), Positives = 37/54 (68%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 P ATQ +IK+AYY+LS+++HPD + + ++F +T AY L ++ ++ YD+ Sbjct: 207 PTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREYDK 260 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/55 (45%), Positives = 38/55 (69%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDRG 420 P AT +IK +Y KL+ +HPDK+ DE +F+ I++AYEVL + + +K+YD G Sbjct: 74 PTATATEIKKSYRKLALKYHPDKNPDEGD--RFKQISQAYEVLSDEKKRKIYDEG 126 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 A+ NDIK AY KL+K HPDK+ D +KF+ IT AYE+L + + +++YDR Sbjct: 16 ASDNDIKKAYRKLAKELHPDKNPDTG--EKFKDITFAYEILSDPEKRELYDR 65 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 A+ +DIK AY K + +HPDK+K + +KF+ I+EAYEVL + + K++YD+ Sbjct: 15 ASADDIKKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVLSDPKKKEIYDQ 66 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 A+ NDIK AY KL+K HPDK+ D +KF+ IT AYE+L + + +++YDR Sbjct: 16 ASDNDIKKAYRKLAKELHPDKNPDTG--EKFKDITFAYEILSDPEKRELYDR 65 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 52.0 bits (119), Expect = 5e-07 Identities = 22/52 (42%), Positives = 37/52 (71%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 A+ ++K AY K + +HPDK+KD + +KF+ I EAYEVL + Q ++++D+ Sbjct: 15 ASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSDPQKREIFDQ 66 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 1/67 (1%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASI-KKFRAITEAYEVLGNIQLKKMYDRGLLVGRE 438 A++N IK AY KL+ HPDK+KD+ +KF I AYEVL + +K+YD+ G + Sbjct: 36 ASKNQIKRAYRKLAMKLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQRKIYDQRGEEGLK 95 Query: 439 NTSRMEY 459 N ++ Sbjct: 96 NAGHRDH 102 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/52 (40%), Positives = 35/52 (67%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 A+ IK A+ K++ +HPDK+K + + +KFR + EAYEVL + ++ YD+ Sbjct: 37 ASDKQIKKAFRKMAVKYHPDKNKGKDAEEKFREVAEAYEVLSDENKRRQYDQ 88 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/62 (37%), Positives = 41/62 (66%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDRGLLVGREN 441 A+ +DIK AY + + + HPDK+K+ + +KF+ I+EAY+VL + + + ++D G + Sbjct: 15 ASDDDIKKAYRRQALIFHPDKNKNSGAEEKFKEISEAYKVLTDPRQRDIFDMYGEEGLKG 74 Query: 442 TS 447 TS Sbjct: 75 TS 76 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/52 (42%), Positives = 35/52 (67%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 AT DIK Y KLS +HPDK+++ ++ KFR EAY+VL + + + +Y++ Sbjct: 15 ATDADIKKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSDPKKRAIYNQ 66 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 45.2 bits (102), Expect = 6e-05 Identities = 37/146 (25%), Positives = 72/146 (49%), Gaps = 5/146 (3%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPD---KSKDEASIKKFRAITEAYEVLGNIQLKKMYDRGLLVG 432 A++++IK AY K+S HPD K + E + +KF+A++++Y +L + + + +YD + Sbjct: 26 ASESEIKRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRAIYDESGEID 85 Query: 433 RENTSRMEYKPEPEPTDPTLKFYKSLQLAISHPPWTGKFQFMTLIVG--PNTIIQMYLQS 606 EN E + I +TG +T ++G PN ++ L+ Sbjct: 86 EENID------EDRDWTQYWRLLSKRLFIIGKSVFTGGKVLITYVIGQDPNRKKKVTLED 139 Query: 607 RNMIRKWYETHKKNNRKY*NLLSKKE 684 IRK+ ++K ++ + +L+S E Sbjct: 140 ---IRKFEASYKGSDEELSDLMSAYE 162 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKD--EASIKKFRAITEAYEVLGNIQLKK 405 ATQ +IK Y KL+ HPD+ +D E + K F I EAYE+L ++ K+ Sbjct: 805 ATQEEIKKRYKKLAMKWHPDRHRDNKEEAQKHFMEIQEAYEILSKLKTKR 854 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDK----SKDEASI--KKFRAITEAYEVLGNIQLKKMYDRG 420 A++++IK AY K + HHPD+ S ++ I K+F+ + EAY +L + + K+ YD G Sbjct: 170 ASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYDSG 228 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDK----SKDEASI--KKFRAITEAYEVLGNIQLKKMYDRG 420 A++++IK AY K + HHPD+ S ++ I K+F+ + EAY +L + + K+ YD G Sbjct: 170 ASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYDSG 228 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/52 (38%), Positives = 36/52 (69%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYDR 417 AT +DI+ AY +L+ +HPD K+ + + F+ ++EAYEVL + Q ++ +D+ Sbjct: 15 ATTDDIRRAYRRLALKYHPD--KNAGTEENFKEVSEAYEVLCDPQQRERFDK 64 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/46 (50%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDK---SKDEASIKKFRAITEAYEVLGN 390 A++ DIK +Y KL+ HPDK +K+EA +KF+ I+EAYEVL + Sbjct: 14 ASEQDIKKSYRKLALKWHPDKNPQNKEEAE-RKFKEISEAYEVLSD 58 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/51 (39%), Positives = 32/51 (62%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIQLKKMYD 414 ATQ +I+ AY ++S HPD++K++ + KFR + EVL + +K YD Sbjct: 2494 ATQAEIRRAYRRISLQLHPDRNKEDDAELKFRKLVAVAEVLKDEDKRKRYD 2544 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/54 (37%), Positives = 36/54 (66%), Gaps = 2/54 (3%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKD--EASIKKFRAITEAYEVLGNIQLKKMYDR 417 A++ D+K AY + + HPDK+ E + +KF+ ++EAYEVL + + + +YD+ Sbjct: 15 ASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKRDIYDK 68 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +1 Query: 256 PK-ATQNDIKTAYYKLSKVHHPDKSKDEA-SIKKFRAITEAYEVLGNIQLKKMYDRGL 423 PK A+Q +IK+A+ K +K HPD + D+ S K F ++EAY L + ++ YD L Sbjct: 16 PKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQYDARL 73 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +1 Query: 256 PK-ATQNDIKTAYYKLSKVHHPDKSKDEA-SIKKFRAITEAYEVLGNIQLKKMYDRGL 423 PK A+Q +IK+A+ K +K HPD + D+ S K F ++EAY L + ++ YD L Sbjct: 77 PKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQYDARL 134 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +1 Query: 277 IKTAYYKLSKVHHPDKSKDEA--SIKKFRAITEAYEVLGNIQLKKMYDR 417 +K Y KL+ HPDK+ D A S + FR I +AY+VL + Q + YD+ Sbjct: 20 LKKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSDPQERAFYDK 68 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 37.9 bits (84), Expect = 0.009 Identities = 14/33 (42%), Positives = 24/33 (72%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDKSKDEASIKKF 354 P AT +IK+AYY+LS+++HPD + + ++F Sbjct: 84 PTATLREIKSAYYELSRIYHPDLNSSAEARERF 116 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 253 QPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAIT 366 Q AT++DI AY KL+ + HPDKS S + F+A++ Sbjct: 151 QQGATKDDINRAYKKLAVLIHPDKSVAPGSEEAFKALS 188 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGN 390 A+ +I+ Y LSK +HPDK + +KF I +AYE + + Sbjct: 1259 ASVAEIRRQYRSLSKKYHPDKETGDP--RKFMRIAKAYEAVSD 1299 >SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 555 YDFDSWSKHHYSDVFAKQKYDKEMVRNSQEKQQKILESTKQE 680 YDFDSW + Y D K+K + R EK+ + + +++ Sbjct: 191 YDFDSWREFSYLDEEEKEKGENRDERRWIEKENRAMRQKRKK 232 >SB_30672| Best HMM Match : Colipase (HMM E-Value=6.5) Length = 305 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 166 LTEHLQINSCMF-QKFLHGNQIYFLY 92 L E L+ NSC+ KFLH ++Y+LY Sbjct: 159 LVEPLKANSCLMPSKFLHTRKLYYLY 184 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 262 ATQNDIKTAYYKLSKVHHPDKSKDEASIKK-FRAITEAYEVLGNIQLKKMYDRGLLVGRE 438 +T+ +I AY K + HPDK+ D + F +++A EVL + + + ++ L Sbjct: 18 STEKEILKAYRKKALKCHPDKNPDNPKASELFHKLSKALEVLTDPKARAAFNNLLNAKER 77 Query: 439 NTSR 450 N R Sbjct: 78 NKLR 81 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDK 324 P+A+ +DIK Y KL+ + HPDK Sbjct: 809 PEASDDDIKRQYRKLAVLIHPDK 831 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 256 PKATQNDIKTAYYKLSKVHHPDK 324 P+A+ +DIK Y KL+ + HPDK Sbjct: 7 PEASDDDIKRQYRKLAVLIHPDK 29 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +3 Query: 564 DSWSKHHYSDVFAKQKYDKEMVRNSQEKQQKILESTKQE 680 + W K + A+ + K+M++N +E++ +IL T+QE Sbjct: 186 EQWRKEGVARREAELEAKKQMMKNMEEEELRILRKTRQE 224 >SB_56284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 124 FLHGNQIYFLYINTCRV*CFCIEVLSY 44 ++ GN+IY L +N C V F I ++SY Sbjct: 165 YILGNKIYTLIVNVCIVVLFGITIVSY 191 >SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) Length = 106 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +1 Query: 268 QNDIKTAYYKLSKVHHPDKSKD 333 ++ I+ AY++L++ +HPDK+ D Sbjct: 83 ESKIRKAYFRLAQKYHPDKNPD 104 >SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) Length = 168 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 199 TIYYLTSILCQPL*CAWSQPKATQNDIKTAYYKLSKVHHP 318 TI Y +S + P+ QP + + T Y+ S+++HP Sbjct: 27 TILYQSSCINHPVSTILYQPSCISHPVSTIRYQPSRINHP 66 >SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +3 Query: 543 KVPIYDFDSWSKHHYSDVFAKQKYDKEMVRNSQEKQQKI 659 K+P+Y+F + KH D+ + +E + N +E +++ Sbjct: 13 KIPLYNFQPFLKHSTDDILVTGRDSEEHLTNLEEVLRRL 51 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +2 Query: 464 QNQNLQILP*SFTSPCN--SQYHTHHGRESSNL 556 +N+ QI P S T+P + SQ HTH SSNL Sbjct: 259 ENRRTQIEPASSTTPTSQASQQHTHAQYSSSNL 291 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Frame = +1 Query: 253 QPKATQNDIKTAYYKLSKVHHPDK--------SKDEASIKKFRAITEAYEVL 384 +P IK AY KL HHPDK E + +K + I +AYE++ Sbjct: 83 KPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELI 134 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,214,001 Number of Sequences: 59808 Number of extensions: 496935 Number of successful extensions: 1231 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1217 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -