BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120570.Seq (781 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding pr... 25 2.6 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 6.1 >AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding protein AgamOBP28 protein. Length = 134 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 631 ETHKKNNRKY*NLLSKKELFGLL*S*VDCLLRCYLMDSMIMD 756 E HK N+++ LL + F + + C LRC+L + MD Sbjct: 36 EQHKGLNKEHLVLLRDGD-FSKVDADTKCFLRCFLQQANFMD 76 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.8 bits (49), Expect = 6.1 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 247 WSQPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAY--EVLGNI 393 W A +ND Y VHHP + + ++F T Y EVL I Sbjct: 72 WRGATANRNDSSVHYQPPPTVHHPADAVTLSPAQEFDQQTFVYYAEVLSVI 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 837,581 Number of Sequences: 2352 Number of extensions: 16056 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -