BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120570.Seq (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 22 7.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.7 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.8 bits (44), Expect = 7.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 364 TEAYEVLGNIQLKKMYDRGLLVGRENTSRMEYKPEPEPTDPTL 492 TEA+EV L K + + L + T + + E E T+P L Sbjct: 79 TEAFEVDLEFYLGKEWKKNLNLRDSVTKYLIHLKEIEDTEPIL 121 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 451 YEKYSLYQLRDLYHTF 404 YE+Y +Y+L +L +F Sbjct: 406 YEEYKMYELGELASSF 421 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,256 Number of Sequences: 438 Number of extensions: 5365 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -