BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120569.Seq (804 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 3.8 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 5.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.7 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.7 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 399 HNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRMTNL 518 H+P A + LP+GA L ++ G+V +A G + L Sbjct: 35 HSPCATGSN-GLPAGAGSNLLCASNGLVTTLASGSSLNGL 73 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 5.0 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 247 QIGLCRXFGSNEELLPCLELVWIAEVYNSQRCT-STRVMDY 128 ++ FG+ L +L+W EV N R + DY Sbjct: 173 RLSAANFFGARHGLETLNQLIWFDEVVNELRILHGVEIRDY 213 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.7 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +2 Query: 374 WKLRHCDWTQS 406 W HCDW ++ Sbjct: 2271 WNKDHCDWPEN 2281 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 454 TFLAPDGSFTLVR 416 T PDG FT++R Sbjct: 579 TVTVPDGGFTIIR 591 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,730 Number of Sequences: 336 Number of extensions: 4443 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -