BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120559.Seq (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15981| Best HMM Match : Defensin_2 (HMM E-Value=1.1) 29 5.4 SB_11728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_47115| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_15981| Best HMM Match : Defensin_2 (HMM E-Value=1.1) Length = 890 Score = 28.7 bits (61), Expect = 5.4 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 8/81 (9%) Frame = +1 Query: 538 ETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKADTRQIAAVVF-------STLAFIHNRF 696 +T++ LAL Y E+T LLE+ N+ D + + F S L + RF Sbjct: 753 DTVEQSLALHVYGVEEPGTEITVDLLEVLHNRLDDATLEVISFMLARNPGSKLTYADVRF 812 Query: 697 -HPLVTNFTNKMEFVVTETND 756 PL T+ T + FV+ ++ Sbjct: 813 IQPLGTSPTVTLRFVIPPVDE 833 >SB_11728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 521 Score = 28.7 bits (61), Expect = 5.4 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 8/81 (9%) Frame = +1 Query: 538 ETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKADTRQIAAVVF-------STLAFIHNRF 696 +T++ LAL Y E+T LLE+ N+ D + + F S L + RF Sbjct: 229 DTVEQSLALHVYGVEEPGTEITVDLLEVLHNRLDDATLEVISFMLARNPGSKLTYADVRF 288 Query: 697 -HPLVTNFTNKMEFVVTETND 756 PL T+ T + FV+ ++ Sbjct: 289 IQPLGTSPTVTLRFVIPPVDE 309 >SB_47115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 830 Score = 27.9 bits (59), Expect = 9.5 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = -1 Query: 725 LLVKLVTSGWNLLC-IKANVLNTTAAICRVSALFLNISNSGWVISRVLSIAMYLLSANLI 549 L+ K VT NLL ++ ++L + V+ F +I +SG + +LS+ M + L Sbjct: 357 LIRKFVTELLNLLFNVRFSILLPKLMLVVVAFGFYSIHSSGGAMGALLSLMMLTMLRCLP 416 Query: 548 FRVS*LSKLLRFFNQIRPIRRFFG 477 FR+ + ++ F + +FG Sbjct: 417 FRIRSFNFMIIFSLLMNIANAYFG 440 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,882,521 Number of Sequences: 59808 Number of extensions: 361758 Number of successful extensions: 738 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -