BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120559.Seq (764 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ578339-1|CAE18340.1| 106|Homo sapiens immunoglobulin lambda-1... 30 7.9 AF121407-1|AAD29356.1| 95|Homo sapiens immunoglobulin lambda l... 30 7.9 >AJ578339-1|CAE18340.1| 106|Homo sapiens immunoglobulin lambda-1 variable region protein. Length = 106 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 489 TNWPNLIKKSKQFRKL*NSEN*IGAQQIHGYAQHPGNDPAAV 614 T P++ + Q ++ N IG++ +H Y Q PG DP V Sbjct: 2 TQPPSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLV 43 >AF121407-1|AAD29356.1| 95|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 95 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 489 TNWPNLIKKSKQFRKL*NSEN*IGAQQIHGYAQHPGNDPAAV 614 T P++ + Q ++ N IG++ +H Y Q PG DP V Sbjct: 4 TQPPSVSVATAQMARISCGGNNIGSKAVHWYQQKPGQDPVLV 45 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,614,959 Number of Sequences: 237096 Number of extensions: 1690153 Number of successful extensions: 3783 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3783 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -