BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120555.Seq (783 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14C8.14c |pol5||DNA polymerase phi|Schizosaccharomyces pombe... 26 7.0 SPAC1071.10c |pma1||P-type proton ATPase Pma1 |Schizosaccharomyc... 25 9.3 >SPBC14C8.14c |pol5||DNA polymerase phi|Schizosaccharomyces pombe|chr 2|||Manual Length = 959 Score = 25.8 bits (54), Expect = 7.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 648 KTHFKANLFNKYITVKVLQNCRRQYNTAAA 559 K+H+ AN+F+ +I Q + Q + AA Sbjct: 914 KSHYNANIFHDFINWGAQQRLKHQQTSTAA 943 >SPAC1071.10c |pma1||P-type proton ATPase Pma1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 919 Score = 25.4 bits (53), Expect = 9.3 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 2/75 (2%) Frame = +1 Query: 547 LPTWRRSRVVLTTAILQNLYCDIFIK*VCFKMSFFTNLRRVNK--LYPNQASFLADNTRL 720 +P+W+ S VL IL ++C IF FK T++ V + +Y + T Sbjct: 820 IPSWQLSGAVLAVDILATMFC-IF---GWFKGGHQTSIVAVLRIWMYSFGIFCIMAGTYY 875 Query: 721 LTSTPAGFTNVLNAQ 765 + S AGF ++N + Sbjct: 876 ILSESAGFDRMMNGK 890 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,741,050 Number of Sequences: 5004 Number of extensions: 50080 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -