BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120554.Seq (822 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 25 0.55 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 8.9 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 25.4 bits (53), Expect = 0.55 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 385 YISMSLLYQLQCLYHLTSIIETKVLIPSELKYSLHSVDLNT 263 Y+++ + + H+ SI+ T IPSE++ + LNT Sbjct: 313 YLTICTIMSAAAVEHILSIVNTCSQIPSEVEDKYTTYFLNT 353 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 441 HHIYNVLISYFSFCFLIVHIYQCRYCI 361 H ++ I YF F+I I+ YC+ Sbjct: 205 HLLFLPCIYYFYSAFIIFTIHLLFYCV 231 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,904 Number of Sequences: 336 Number of extensions: 4284 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22517873 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -