BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120554.Seq (822 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43478| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 >SB_43478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 67.7 bits (158), Expect = 1e-11 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = +2 Query: 2 SRAHLQKRTPKDGTDREAYLSLLVDEYLHSSSYEAKLQVLANLANFAYDPVNYSYIRDVG 181 S+ ++ +++ KD R YL LV E+ + + K QVLANLANFAYDP+NY + R + Sbjct: 4 SQEYIDRKSGKDRLGRLEYLQALVTEFQDTHKQDNKEQVLANLANFAYDPINYEHFRKLN 63 Query: 182 VLDIFL 199 VLD+FL Sbjct: 64 VLDLFL 69 >SB_40961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 265 CLDPLNADYILTHLGLKPLFRLLKSSDTDTVADTITTLIYMYNEKTKTEI 414 CLD ++ D + HL + + L S TD A +T Y+Y + TE+ Sbjct: 4 CLDSVHTD-VQAHLLTQTNYVYLDSVHTDVQAHLLTQTNYVYLDSVHTEV 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,061,334 Number of Sequences: 59808 Number of extensions: 482498 Number of successful extensions: 1178 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1177 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -