BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120551.Seq (807 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) 55 8e-08 SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) 44 2e-04 >SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) Length = 102 Score = 54.8 bits (126), Expect = 8e-08 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = +1 Query: 130 IYYTANIEIAFYRVNYICRNVNYG*IIRTLHANGASFFFICI 255 ++Y A++ +AF V++I R+VNYG ++R HANGAS FFIC+ Sbjct: 1 MHYCADVSLAFASVDHIMRDVNYGFLLRYAHANGASMFFICL 42 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 237 IFFYLHYLHIGRGIYYKSFN 296 +FF Y HIGRG+YY S++ Sbjct: 37 MFFICLYAHIGRGLYYGSYS 56 >SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) Length = 135 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = +3 Query: 363 YVLP*GQISFWGATVITNLLSAIPYLGTILVN*I*GGFAVDNATLTRF 506 Y LP QI +W ++T + AIP +G+ LV + G +V +TLTRF Sbjct: 64 YSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTRF 111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,658,431 Number of Sequences: 59808 Number of extensions: 264438 Number of successful extensions: 415 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -