BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120550.Seq (831 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0235 + 32539025-32539886,32540330-32540473,32540595-325407... 32 0.49 09_03_0125 - 12531409-12531442,12531577-12531668,12531747-125323... 31 1.5 05_04_0163 + 18652306-18652839,18653785-18653853,18655139-186552... 30 2.0 07_03_1017 - 23318187-23318348,23318747-23318857,23319859-233199... 30 2.6 06_03_1155 - 28065126-28065139,28065268-28065324,28065571-28066312 30 2.6 06_03_1150 + 28022633-28023374,28023501-28023565 30 2.6 01_06_0199 - 27467548-27469992 30 2.6 09_06_0268 + 21942591-21942690,21942821-21942904,21943116-219431... 29 3.4 06_03_0905 + 25843547-25844314 29 3.4 02_01_0791 - 5930553-5930802,5931042-5932351 29 3.4 11_01_0066 - 536281-537196,537397-537452 29 4.5 08_02_1227 - 25398063-25398302,25398629-25398790,25399019-253991... 29 4.5 06_03_0661 + 23225514-23227073 29 6.0 05_05_0079 + 22239238-22239395,22240837-22240877,22240955-222410... 29 6.0 04_03_0258 - 13573730-13573816,13573881-13574666,13575043-135751... 29 6.0 03_03_0254 + 15884149-15884295,15884765-15884803,15884958-158851... 29 6.0 11_06_0610 - 25449085-25453284 28 7.9 01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956,647... 28 7.9 01_01_0668 - 5109476-5110112,5110196-5110439,5110519-5110917,511... 28 7.9 >03_06_0235 + 32539025-32539886,32540330-32540473,32540595-32540747, 32540871-32540986,32541254-32541421,32541534-32541758, 32541884-32542015 Length = 599 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +1 Query: 100 APKTGGKGRVKSLPTPVANSPLSPVRQPPK 189 AP GG+GR+ + P P +++PL+ +PP+ Sbjct: 40 APDGGGQGRLPAPPPPTSDAPLAVQNKPPE 69 >09_03_0125 - 12531409-12531442,12531577-12531668,12531747-12532337, 12532454-12532789,12532899-12533156,12533867-12533971, 12534625-12534702,12535464-12535542,12535649-12535723, 12535828-12535946,12536042-12537106 Length = 943 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/44 (34%), Positives = 28/44 (63%) Frame = -3 Query: 166 TAASWRQALAKI*HGPCHRSLARQKCYSLEKNGSL*LLVSTQKS 35 +A+ WR LA++ P S +++ S+++ GS +LVST+K+ Sbjct: 247 SASWWRPVLARMVGRPVSVSGLKKRLVSIDRKGSYTMLVSTRKT 290 >05_04_0163 + 18652306-18652839,18653785-18653853,18655139-18655270, 18655424-18655477,18655570-18655614,18656166-18656305, 18657107-18657232,18657325-18657361 Length = 378 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +3 Query: 294 VNRKDGYFVPPEFGNKLESLPA 359 VNR++ FV + G KLESLPA Sbjct: 95 VNRREALFVLAQLGRKLESLPA 116 >07_03_1017 - 23318187-23318348,23318747-23318857,23319859-23319964, 23320113-23320153 Length = 139 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/56 (25%), Positives = 32/56 (57%) Frame = -3 Query: 694 IAFLTAYVYAVRIVQRLFDVNHNIQKPCARVVFESIIASGASRIAHVLLRSLFVFY 527 + +T + + +++ V HN+++ + +SII G++ + HV+L +LF F+ Sbjct: 78 LVVMTCFPLQMTLIKAQAGVKHNMRR-----MNKSIIQQGSNHVVHVVLFALFCFF 128 >06_03_1155 - 28065126-28065139,28065268-28065324,28065571-28066312 Length = 270 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 2/87 (2%) Frame = +1 Query: 100 APKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPPTRISLPTRTFSANPLDAXSAAAL* 279 AP + G G + P P +SP+SP Q ++ P S P PL + + A Sbjct: 120 APPSSGSG-FPAFPFPFPSSPVSPPSQASPASPAAPAPPSPPQPKECLTPLLSMMSCADY 178 Query: 280 VKNQSSTEKMDILCR--PSLVTNWKVC 354 + N S+ C SLV+ +C Sbjct: 179 LTNSSAQTPPGTCCEGFKSLVSTAPIC 205 >06_03_1150 + 28022633-28023374,28023501-28023565 Length = 268 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 2/87 (2%) Frame = +1 Query: 100 APKTGGKGRVKSLPTPVANSPLSPVRQPPKSNIKPPTRISLPTRTFSANPLDAXSAAAL* 279 AP + G G + P P +SP+SP Q ++ P S P PL + + A Sbjct: 120 APPSSGSG-FPAFPFPFPSSPVSPPSQASPASPAAPAPPSPPQPKECLTPLLSMMSCADY 178 Query: 280 VKNQSSTEKMDILCR--PSLVTNWKVC 354 + N S+ C SLV+ +C Sbjct: 179 LTNSSAQTPPGTCCEGFKSLVSTAPIC 205 >01_06_0199 - 27467548-27469992 Length = 814 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 494 YAHDGKFASSSVKYKKTTEQHMSDSRCTTCNYRF 595 Y +D F SS+ ++ Q +SD +C +YRF Sbjct: 351 YGYDLMFNGSSITFELCRNQCLSDCQCVAFSYRF 384 >09_06_0268 + 21942591-21942690,21942821-21942904,21943116-21943192, 21943266-21943336,21943646-21943717,21943894-21943965, 21944057-21944122,21944411-21944476,21944553-21944770, 21944983-21945254,21945513-21945778,21945879-21945999, 21946094-21946230,21946362-21946518,21947055-21947189 Length = 637 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/83 (24%), Positives = 36/83 (43%) Frame = +3 Query: 228 AHFFGQSVGRXFSSSIVSKKPVVNRKDGYFVPPEFGNKLESLPAYSDKLDFKQERDLRMH 407 +H++ GR SS++ K + G PP K S + +KL+ + + Sbjct: 268 SHYYTDESGRRNSSAVNMKSLEHSPSMGCKTPPAVPRKSMSDNEFENKLNHSRRSTDPIS 327 Query: 408 FMSDLERNIMKATLKFSTNYIMG 476 M+ ++ AT FS+N +G Sbjct: 328 LMNHSSSDLQAATGNFSSNRQLG 350 >06_03_0905 + 25843547-25844314 Length = 255 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 139 PTPVANSPLSPVRQPPKSNIKPPTRISLPTRTFSANPL 252 P P+ P PV PPK + P ++ PT + P+ Sbjct: 76 PPPLVAPPKVPVTHPPKGPVTRPPPVTYPTPPVTTPPV 113 >02_01_0791 - 5930553-5930802,5931042-5932351 Length = 519 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +2 Query: 71 VFFERITFLTRQRPVARAVSNLCQRLSPTRRC 166 VF + FLTR RPV V C + P RRC Sbjct: 89 VFLSTVRFLTRPRPV-YLVDFACYKPPPERRC 119 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 139 PTPVANSPLSPVRQPPKSNIKPPTRISLPTRT 234 P +A P SP PP S PP PT T Sbjct: 217 PPSIATPPPSPASPPPPSTATPPPPSPTPTTT 248 >08_02_1227 - 25398063-25398302,25398629-25398790,25399019-25399150, 25399909-25399961,25400465-25400942 Length = 354 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 151 ANSPLSPVRQPPKSNIKPPTRISLP 225 A SPL P PP SN +PP S+P Sbjct: 328 AGSPLHPGIAPPSSNSQPPFLSSMP 352 >06_03_0661 + 23225514-23227073 Length = 519 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 71 VFFERITFLTRQRPVARAVSNLCQRLSPTRRC--RLFVSRQNLTSNHLRASL 220 VF + FLTR RPV + C + P R+C F+ +LT + A+L Sbjct: 93 VFLSTLYFLTRPRPV-YLLDFACYKPDPQRKCTRETFMRCSSLTGSFTDANL 143 >05_05_0079 + 22239238-22239395,22240837-22240877,22240955-22241033, 22241570-22241656,22241749-22241837,22241933-22242004, 22242094-22242186,22242339-22242427 Length = 235 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 621 CMLWFTSKSRWTILTA*TYAVKNAIYITTFQRPRTK 728 CMLW TS S T+L A A+ + +F+ P K Sbjct: 154 CMLWLTSCSLLTVLWALLIAIFATLLHASFRTPNLK 189 >04_03_0258 - 13573730-13573816,13573881-13574666,13575043-13575126, 13575254-13575322,13575324-13576228,13576517-13576784 Length = 732 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -2 Query: 578 WCIANRSCAAP*SFCILQNCLQISRHAHIFTVYITH 471 WC+ N SC P ++++CL + H +I +++ H Sbjct: 687 WCLQNDSCQRPSMSMVVKSCLLKAIHRYIL-LHLLH 721 >03_03_0254 + 15884149-15884295,15884765-15884803,15884958-15885136, 15887175-15887310,15887769-15887865,15888448-15888534, 15888621-15888721,15888905-15888939,15889520-15889577, 15889650-15889724,15890048-15890135,15890155-15890308, 15890395-15890638 Length = 479 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -2 Query: 512 ISRHAHIFTV--YITHNVIGGKF*RGFHDVAF*IAHKMHT*ITLLFEIQF 369 +SR HIF++ +IT+ I + G HD+ + HK+H + +E +F Sbjct: 127 LSRFKHIFSMNEHITNPNIPIYYLSGNHDIGYSAFHKIHPEVISRYEKEF 176 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 127 VKSLPTPVANSPLSPVRQPPKSNIKPPTRISLPTRTFSANP 249 VKSLP P +P+S + PP ++ PP +SLP + P Sbjct: 1261 VKSLPPP---APVS-LPPPPVKSLPPPAPVSLPPPVVKSLP 1297 >01_01_0829 + 6471032-6471870,6472490-6472685,6472772-6472956, 6473206-6473539,6473629-6473833,6474927-6475033, 6475117-6475269 Length = 672 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 514 CKQFCKIQKDYGAAHERFAMHHLQL 588 C++ +I YG AH+R A H++L Sbjct: 257 CEEAVRIDPSYGRAHQRLASLHIRL 281 >01_01_0668 - 5109476-5110112,5110196-5110439,5110519-5110917, 5111390-5111668,5111886-5112257,5112371-5112475, 5112832-5112909,5112990-5113199,5113287-5113406, 5113508-5113606,5113685-5113750,5113914-5114141, 5114216-5114521,5115324-5115381 Length = 1066 Score = 28.3 bits (60), Expect = 7.9 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 118 KGRVK-SLPTPVANSPLSPVRQPPKSNIKPPTRISLPTRTFSANPLDAXSAA 270 KG V ++PT N+P +PV P + N PP ++ P T A P+ AA Sbjct: 99 KGAVSPAVPTRPQNAP-TPVTPPKEYNAPPPVELTPPAPTHVA-PVAPPQAA 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,725,533 Number of Sequences: 37544 Number of extensions: 489111 Number of successful extensions: 1552 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1546 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -