BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120549.Seq (765 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 27 0.84 Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 24 5.9 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.6 bits (56), Expect = 0.84 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 650 LPQVWLSQCHRSYLQENQCSHWDSKSIPQ 564 LPQ L R YL+ N C WD K Q Sbjct: 1172 LPQRDLDADMRLYLRTNTCIEWDDKKFWQ 1200 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 23.8 bits (49), Expect = 5.9 Identities = 16/56 (28%), Positives = 21/56 (37%) Frame = -3 Query: 706 QLRQVLIEDRRERAWLPNYFHKFGYHSAIGVICKKTNVPIGTASQYPKLGRICTTG 539 Q RQ+ R R W P + GY + G + V G + G CT G Sbjct: 29 QYRQMTRFHRAPRPWRPTRLRRLGYKAKTGFSIFRIRVRCGGRKRPVHKG--CTYG 82 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 815,765 Number of Sequences: 2352 Number of extensions: 19733 Number of successful extensions: 56 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -