BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120549.Seq (765 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280362-1|AAP35084.1| 2386|Homo sapiens EGF domain-containing p... 32 2.6 AB011541-1|BAA32469.2| 2785|Homo sapiens MEGF8 protein. 32 2.6 >AY280362-1|AAP35084.1| 2386|Homo sapiens EGF domain-containing protein protein. Length = 2386 Score = 31.9 bits (69), Expect = 2.6 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = -2 Query: 533 CLYEAPLKLRGMTGGCRGGPVMVRLDWRCKLCQLEGSLIQFRCISSHTTG 384 C A R GGCRG V + RC+ C +G L C+ SH G Sbjct: 516 CFLFAAYLARYPHGGCRGWDDSVHSEPRCRSC--DGFLTCHECLQSHECG 563 >AB011541-1|BAA32469.2| 2785|Homo sapiens MEGF8 protein. Length = 2785 Score = 31.9 bits (69), Expect = 2.6 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = -2 Query: 533 CLYEAPLKLRGMTGGCRGGPVMVRLDWRCKLCQLEGSLIQFRCISSHTTG 384 C A R GGCRG V + RC+ C +G L C+ SH G Sbjct: 915 CFLFAAYLARYPHGGCRGWDDSVHSEPRCRSC--DGFLTCHECLQSHECG 962 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,768,809 Number of Sequences: 237096 Number of extensions: 2781309 Number of successful extensions: 5330 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5330 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -