BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120548.Seq (856 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. 25 2.2 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 25 2.2 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 24 6.8 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 23 9.0 >Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 25.4 bits (53), Expect = 2.2 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +1 Query: 163 SRRTGGGVAA*KWSLSNCNATFVFRLQKLKIFYATNRQIDYNTSIRTRHV 312 S R GG V KW L+ + T + L + ++R T +R V Sbjct: 71 SHRCGGSVLNSKWILTAAHCTVNLQPSSLAVRLGSSRHASGGTVVRVARV 120 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.4 bits (53), Expect = 2.2 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +3 Query: 630 CRTNAAQH*TTIRFKQITTN*RFYARKVGQN*KRLQQHAQIL*RMQLKRISTEKALKS 803 C + Q T + ++N R Y V ++ K ++HAQ+L ++ LK E+ L++ Sbjct: 271 CHQHEPQEIRTCHWGFNSSNWRSYIH-VAESEKNREEHAQVLDKIWLKEREIEQELEA 327 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 23.8 bits (49), Expect = 6.8 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +1 Query: 175 GGGVAA*KWSLSNCNATFVFRLQKLKIFYATNRQIDYNTSIRTRHV 312 GG V + KW L+ + T L + T+R T +R V Sbjct: 74 GGSVLSSKWVLTAAHCTAGASTSSLTVRLGTSRHASGGTVVRVARV 119 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 23.4 bits (48), Expect = 9.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 650 LSCVCSAMSICSFFSIACDSD 588 LSC+C A S C S+ C D Sbjct: 42 LSCICEASSGCD-ASLRCSGD 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 788,405 Number of Sequences: 2352 Number of extensions: 14564 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -