BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120547.Seq (711 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC150544-1|AAI50545.1| 121|Homo sapiens LOC340204 protein protein. 33 1.0 BC150543-1|AAI50544.1| 121|Homo sapiens LOC340204 protein protein. 33 1.0 BC133046-1|AAI33047.1| 121|Homo sapiens hypothetical protein LO... 33 1.0 AL157823-5|CAI21640.1| 113|Homo sapiens protein ( Human DNA seq... 33 1.0 >BC150544-1|AAI50545.1| 121|Homo sapiens LOC340204 protein protein. Length = 121 Score = 33.1 bits (72), Expect = 1.0 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 170 LAALDFIILMLVTSITHRTLKYNMLNIHEKCFKN--*KRLCANTAPPNCTTY 319 L L F L L+T + KYN+L + E C +N + C AP NC ++ Sbjct: 9 LLFLLFFFLFLLTRGSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESH 60 >BC150543-1|AAI50544.1| 121|Homo sapiens LOC340204 protein protein. Length = 121 Score = 33.1 bits (72), Expect = 1.0 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 170 LAALDFIILMLVTSITHRTLKYNMLNIHEKCFKN--*KRLCANTAPPNCTTY 319 L L F L L+T + KYN+L + E C +N + C AP NC ++ Sbjct: 9 LLFLLFFFLFLLTRGSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESH 60 >BC133046-1|AAI33047.1| 121|Homo sapiens hypothetical protein LOC340204 protein. Length = 121 Score = 33.1 bits (72), Expect = 1.0 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 170 LAALDFIILMLVTSITHRTLKYNMLNIHEKCFKN--*KRLCANTAPPNCTTY 319 L L F L L+T + KYN+L + E C +N + C AP NC ++ Sbjct: 9 LLFLLFFFLFLLTRGSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESH 60 >AL157823-5|CAI21640.1| 113|Homo sapiens protein ( Human DNA sequence from clone RP3-510O8 on chromosome 6 Contains the5' end of the FKBP5 gene for FK506 binding protein 5 (FKBP51), four ). Length = 113 Score = 33.1 bits (72), Expect = 1.0 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 170 LAALDFIILMLVTSITHRTLKYNMLNIHEKCFKN--*KRLCANTAPPNCTTY 319 L L F L L+T + KYN+L + E C +N + C AP NC ++ Sbjct: 1 LLFLLFFFLFLLTRGSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESH 52 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,256,207 Number of Sequences: 237096 Number of extensions: 1852595 Number of successful extensions: 2837 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2837 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8287202872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -