BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120547.Seq (711 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69794-4|CAA93678.3| 654|Caenorhabditis elegans Hypothetical pr... 32 0.35 Z69661-2|CAA93494.1| 925|Caenorhabditis elegans Hypothetical pr... 30 1.9 U39855-1|AAA81080.3| 615|Caenorhabditis elegans Hypothetical pr... 29 3.3 AF067607-11|AAM81119.1| 412|Caenorhabditis elegans Innexin prot... 29 4.3 AF067607-10|AAM81118.1| 436|Caenorhabditis elegans Innexin prot... 29 4.3 U23147-4|AAC46689.1| 464|Caenorhabditis elegans Hypothetical pr... 28 7.6 >Z69794-4|CAA93678.3| 654|Caenorhabditis elegans Hypothetical protein R03G8.3 protein. Length = 654 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/49 (32%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = -2 Query: 455 ICLCKNDVIVQTRFTSRILRVKHDHSTS*L-YRKLFKGSLLMS*LINMS 312 + L N+ I + +FT + +++K DH S L + + FKGS+L + ++ M+ Sbjct: 545 VALAVNNEIEEGKFTDKCVKMKVDHVVSLLQFDQKFKGSMLYTAVVEMT 593 >Z69661-2|CAA93494.1| 925|Caenorhabditis elegans Hypothetical protein F48F7.4 protein. Length = 925 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/68 (27%), Positives = 32/68 (47%) Frame = -1 Query: 420 SLYE*NFTCKTRSQHFVVVSKIVQGLFVNVVID*YVVQFGGAVFAHNRF*FLKHFSCMFS 241 SL+ F C + SQ F+ +Q +++V V QF + + LKHF C+++ Sbjct: 113 SLFVIVFLCLSLSQPFI----FLQSQYISVFC--CVFQFANQILLQSDGLNLKHFKCLYT 166 Query: 240 MLYFKVRC 217 + RC Sbjct: 167 STFLLFRC 174 >U39855-1|AAA81080.3| 615|Caenorhabditis elegans Hypothetical protein F18G5.4 protein. Length = 615 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 172 SRFRFYYFDARHQHYTSHFEIQHAKHTRKMFQELKTI 282 SR F D+R ++ T+HFEI AK +K E TI Sbjct: 33 SRVHFSLLDSRQENDTNHFEIAEAKF-QKPHNEENTI 68 >AF067607-11|AAM81119.1| 412|Caenorhabditis elegans Innexin protein 18, isoform b protein. Length = 412 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 40 NRQTDNKRNYSGYYQFVP*RLSKSKKIW--PQSCWRLQSV*TGL 165 +R D +R GYYQ+VP L+ + + P S WR+ + +GL Sbjct: 93 HRLDDRERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGL 136 >AF067607-10|AAM81118.1| 436|Caenorhabditis elegans Innexin protein 18, isoform a protein. Length = 436 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 40 NRQTDNKRNYSGYYQFVP*RLSKSKKIW--PQSCWRLQSV*TGL 165 +R D +R GYYQ+VP L+ + + P S WR+ + +GL Sbjct: 93 HRLDDRERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGL 136 >U23147-4|AAC46689.1| 464|Caenorhabditis elegans Hypothetical protein C18H9.5 protein. Length = 464 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 509 YV*LICL-CKLINVINI*FICLCKNDVIVQTR 417 ++ LIC+ C N+I + F +C NDVI++ + Sbjct: 35 FIGLICITCTNANMILMNFTVICMNDVIIEQK 66 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,072,650 Number of Sequences: 27780 Number of extensions: 344060 Number of successful extensions: 769 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -