BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120546X.Seq (583 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY099352-1|AAM34494.1| 891|Caenorhabditis elegans gamma-tubulin... 28 5.6 AF040644-1|AAB94969.2| 891|Caenorhabditis elegans Gamma-tubulin... 28 5.6 AC024090-3|AAK67220.3| 370|Caenorhabditis elegans Hypothetical ... 27 7.4 Z82055-2|CAB04844.1| 369|Caenorhabditis elegans Hypothetical pr... 27 9.7 >AY099352-1|AAM34494.1| 891|Caenorhabditis elegans gamma-tubulin ring protein GRIP-1 protein. Length = 891 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 49 NDITPNKTESLKILSTQSVGARNLLEPMQANETKIKLNRI 168 ND K +I +++GARNL++ N T+ KLN + Sbjct: 840 NDENARKARIAEICQKKTIGARNLMD--SVNTTQRKLNEL 877 >AF040644-1|AAB94969.2| 891|Caenorhabditis elegans Gamma-tubulin interacting proteinprotein 1, isoform a protein. Length = 891 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 49 NDITPNKTESLKILSTQSVGARNLLEPMQANETKIKLNRI 168 ND K +I +++GARNL++ N T+ KLN + Sbjct: 840 NDENARKARIAEICQKKTIGARNLMD--SVNTTQRKLNEL 877 >AC024090-3|AAK67220.3| 370|Caenorhabditis elegans Hypothetical protein C52E2.6 protein. Length = 370 Score = 27.5 bits (58), Expect = 7.4 Identities = 20/97 (20%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +1 Query: 55 ITPNKTESLKILSTQSVGARNLLEPMQANETK--IKLNRIETVNVLDFLGSVYDNTIQVI 228 I+PN +L I S + P+ K + L RI + + +F ++ +++ Sbjct: 6 ISPNSVSTLNIQPPTSFSVSSPPFPILRLPPKPFVPLFRILSSRICEFNFELFSMLTKIL 65 Query: 229 VTE*-VCVVGTMSAIALYLEINKLRLKIDEPMQLAIW 336 + C++ S L +E +R+ +D M + +W Sbjct: 66 IFRMNFCLISPTSGKLLNIESGNVRVVLDHLMAIIVW 102 >Z82055-2|CAB04844.1| 369|Caenorhabditis elegans Hypothetical protein T26H2.2 protein. Length = 369 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 277 YLEINKLRLKIDEPMQLAIWPQIFPLLCDEHQNVQLNTDVLINF 408 Y + + KI +QL I P +LC +++ +NT L NF Sbjct: 206 YTSCHAKQAKITPGLQLGILPYAHQVLCSNFEHLDINTSSL-NF 248 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,186,363 Number of Sequences: 27780 Number of extensions: 238237 Number of successful extensions: 738 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1215936170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -