BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120545.Seq (716 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17183| Best HMM Match : DUF348 (HMM E-Value=5.3) 29 3.8 SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 >SB_17183| Best HMM Match : DUF348 (HMM E-Value=5.3) Length = 334 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 155 RIDSHILTTTAIWRPKDFFLEKVAVSRL 238 RI +LT +WRPKD F+E ++++ Sbjct: 6 RICERLLTNDDVWRPKDSFVETKPLAKV 33 >SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/66 (21%), Positives = 34/66 (51%), Gaps = 4/66 (6%) Frame = +3 Query: 327 SIDNEYYYTFRIMSDNKIQEYYGDSQSFKDMEEGKCYDISLNYVKTKFS----QMIQINE 494 +++N++Y + D IQ YY D + + ++ + + N++ +FS + ++E Sbjct: 2055 TLNNKWYRGYIESCDGGIQIYYPDYGNTEIIDVSRLRPLEQNFLSLRFSALKCALSDMDE 2114 Query: 495 YKECEW 512 ++C W Sbjct: 2115 QEQCGW 2120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,343,308 Number of Sequences: 59808 Number of extensions: 409508 Number of successful extensions: 1159 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1158 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -