BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120545.Seq (716 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14270.1 68416.m01806 phosphatidylinositol-4-phosphate 5-kina... 29 4.1 At4g33750.1 68417.m04792 expressed protein 27 9.4 At3g58920.1 68416.m06566 F-box family protein contains F-box dom... 27 9.4 >At3g14270.1 68416.m01806 phosphatidylinositol-4-phosphate 5-kinase family protein similar to SP|Q9Z1T6 FYVE finger-containing phosphoinositide kinase (EC 2.7.1.68) (1- phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) {Mus musculus}; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF01363: FYVE zinc finger, PF00118: TCP-1/cpn60 chaperonin family Length = 1791 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +2 Query: 512 EIETAIPLSAYLTNKHFEN-EDSVN-IIVKSKFIYKKINSN 628 E + A P+S L +K++EN EDSV+ + V Y+ IN N Sbjct: 1313 EFKVAYPVSPALPSKNYENSEDSVSWLSVPFLNFYRSINKN 1353 >At4g33750.1 68417.m04792 expressed protein Length = 148 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 512 EIETAIPLSAYLTNKHFENEDSVNIIVKSKFIYKKINSNLYKI 640 E + IP+SA +TNK F ++S N +S + SN ++ Sbjct: 31 ESDPDIPISADITNKDFIQDESRNSTSESSLLENIAGSNTTEV 73 >At3g58920.1 68416.m06566 F-box family protein contains F-box domain Pfam:PF00646 Length = 470 Score = 27.5 bits (58), Expect = 9.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 656 YKNFNDDSDVVQVECFCQC 712 Y++FNDD + + E +C+C Sbjct: 373 YRDFNDDEEEEEPEYYCEC 391 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,195,284 Number of Sequences: 28952 Number of extensions: 285578 Number of successful extensions: 765 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -