BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120543.Seq (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 3.3 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 9.9 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 9.9 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 9.9 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 9.9 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = -2 Query: 439 WFSIEFTMSFTLRSATAASTEYNGPMT*GIVVPSSSGLTNPSN 311 W E S ++ S Y G MT I + GL P N Sbjct: 342 WVGYEDPESVQIKMDWIKSKGYGGAMTWAIDMDDFHGLCGPKN 384 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 3 NPDEIASGKRLIIKHLQDESQSDI 74 NP + SGK L IK + +++ + Sbjct: 59 NPSRLDSGKELYIKIIPNKNDGTL 82 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 6 PDEIASGKRLIIKHL 50 PD I+ G R+II H+ Sbjct: 488 PDLISDGYRVIISHV 502 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 484 LYTLASLINTFNIVCWFSIEFTMSFTL 404 L+ L+ + TFN + ++I T+ FT+ Sbjct: 197 LFLLSQAVETFNDIFGWTILQTVFFTV 223 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 456 LLTLSVGFQLNLPCPSLYDRRQQRRQN 376 +LTLS +Q + Y + QQR QN Sbjct: 160 MLTLSEIYQFIMDLFPFYRQNQQRWQN 186 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,459 Number of Sequences: 336 Number of extensions: 3148 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -