BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120543.Seq (713 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117200-7|CAB55059.1| 221|Caenorhabditis elegans Hypothetical ... 30 1.9 AF068709-2|AAC19251.2| 429|Caenorhabditis elegans Hypothetical ... 29 4.4 >AL117200-7|CAB55059.1| 221|Caenorhabditis elegans Hypothetical protein Y50E8A.11 protein. Length = 221 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = -2 Query: 421 TMSFTLRSATAASTEYNGPMT*GIVVPSSSGLTNPSNITCFSLNLLTIVTLSLML 257 T T + T +E P T I+ ++ +NPSNI +S+ +L IVTL +++ Sbjct: 118 TTEITTTTTTVLISEV--PSTTPIIKVAAFQQSNPSNIVLYSVLILVIVTLLILV 170 >AF068709-2|AAC19251.2| 429|Caenorhabditis elegans Hypothetical protein C24B9.3a protein. Length = 429 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 124 ITIMPCSLMDTEICLNVRCRSPFAKFKVLIIVDGFDSAYIQATF 255 ++++ S + ICL C S + ++I+VD +AY Q TF Sbjct: 9 VSLLVASTSASHICLQTACSSFNVESDIVIVVDA-SNAYDQVTF 51 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,447,761 Number of Sequences: 27780 Number of extensions: 259651 Number of successful extensions: 475 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1666201324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -