BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120540.Seq (720 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 2.5 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 5.8 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.0 bits (47), Expect = 2.5 Identities = 16/74 (21%), Positives = 29/74 (39%) Frame = -3 Query: 280 QKYRKNVF*LCMLSVLLA*FSKLLFMETIHLLNSVKKVRPLPSTIKLWLKYFENKKHNES 101 Q+ + F L +L F+K + + K+ S +++W K K + Sbjct: 127 QRRERTTFTRAQLDLLEGLFAKTRYPDIFMREEVAVKINLPESRVQVWFKNRRAKCRQQL 186 Query: 100 ISSRNNCASKHTFS 59 +N AS+ T S Sbjct: 187 QQQQNKSASRTTTS 200 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = -1 Query: 342 YVCKYCIMVLNWGTCLMNSSRKNIEKMFFNCVCC 241 ++CKYC L+ R + ++ ++C C Sbjct: 80 FICKYCNRQFTKSYNLLIHERTHTDERPYSCDIC 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,513 Number of Sequences: 336 Number of extensions: 4530 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -