Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120539X.Seq
         (603 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0126 + 12835431-12838183,12838471-12838566,12838920-128389...    27   8.7  

>08_02_0126 + 12835431-12838183,12838471-12838566,12838920-12838971,
            12839198-12839298,12839349-12839370
          Length = 1007

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +2

Query: 59   CTPQCICCPCFLFKWLRKLDVQLLYPLTFVIISSGYFLHRAVILF 193
            CT QC C       +L  + +++L  L  +I ++G  L+    LF
Sbjct: 939  CTGQCFCSSLSRLYYLYPIKIEILANLGQIITTNGRELYAKACLF 983


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,398,394
Number of Sequences: 37544
Number of extensions: 279382
Number of successful extensions: 749
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 749
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1431112012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)