BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120539X.Seq (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55360| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 >SB_55360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 210 PEESSGNKITALCKKYPEDMMTKVKGYNNCTSNFLSHLKRKHGQ 79 PE S N + C + E MM +V+ + + L LKR++GQ Sbjct: 798 PETSYENLVAQQCTEIEEAMMNEVQRFYIAWNKKLEELKRRNGQ 841 >SB_32165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +2 Query: 104 LRKLDVQLLYPLTFVIISSGYFLHRAVILFPDDSSGRCLKYIP 232 L K + LL + F SGY H+ V FPDD GR + P Sbjct: 9 LIKTQIHLLRRILFAR-QSGYQSHKIVPCFPDDGQGRFSRINP 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,771,390 Number of Sequences: 59808 Number of extensions: 316561 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -