BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120539X.Seq (603 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.3 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.0 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/54 (25%), Positives = 19/54 (35%) Frame = -2 Query: 317 PLSPLPSTNTADDVAASESSRNCGFFYFTVYILSTCLKNHREIKSQLCARNTLK 156 PL+ PS +A + FT+Y + K RE S R K Sbjct: 566 PLARTPSVMSASSTCKKDKKNAGSGSRFTIYKANKASKKKREKSSAKKERKATK 619 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -2 Query: 86 MDSKCI-EEYKSYAKRKREKEKSE 18 M +C+ EY+ KRK EK + E Sbjct: 252 MRPECVVPEYQCAVKRKEEKAQKE 275 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 430 PPWSTSVWQPAIDTK 474 P W T VW+ D K Sbjct: 420 PAWKTHVWKKGRDKK 434 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,996 Number of Sequences: 438 Number of extensions: 3046 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -