BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120535.Seq (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 24 1.3 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 24 1.3 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 24 1.3 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 23 3.0 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = +3 Query: 75 NNELQEIKSILVVMYESMEKHFSNVVDEIDSLK 173 NN+ + + +V +++ E F ++ E+DS++ Sbjct: 44 NNQPVHDEHLFIVTHQAYELWFKQIIYELDSIR 76 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = +3 Query: 75 NNELQEIKSILVVMYESMEKHFSNVVDEIDSLK 173 NN+ + + +V +++ E F ++ E+DS++ Sbjct: 44 NNQPVHDEHLFIVTHQAYELWFKQIIYELDSIR 76 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = +3 Query: 75 NNELQEIKSILVVMYESMEKHFSNVVDEIDSLK 173 NN+ + + +V +++ E F ++ E+DS++ Sbjct: 44 NNQPVHDEHLFIVTHQAYELWFKQIIYELDSIR 76 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 51 YLVYAGHLNNELQEIKSILVVMYESMEKHFSNVVDEIDSLKTDTF 185 + +Y H + ++I++ + + +EK V I SL DTF Sbjct: 279 FAIYEMHWYDASKQIQNEVFIFMGQLEKPIVFYVANIFSLDLDTF 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,473 Number of Sequences: 336 Number of extensions: 3328 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -